SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020042 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020042
Domain Number 1 Region: 127-236
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000144
Family Second domain of FERM 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020042   Gene: ENSCAFG00000013615   Transcript: ENSCAFT00000021584
Sequence length 463
Comment pep:novel chromosome:CanFam3.1:18:51782574:51806874:-1 gene:ENSCAFG00000013615 transcript:ENSCAFT00000021584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRA
VREVLQLPDIALDAFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTDAPDDDVAMDE
PSLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCDTLGSLMCPVRL
GPYLPGLPTACALTEKLDSFLPAHLCKRGHGLFAALRGRGAKAGTGEQGLLNAYCKVKEA
GDGEHGASLSTHYRAYLLKSHELPFYGCAFFHGEVDKPAQGFLHRGGRKQVAVAISLEGV
HVIDSREKHVLLGLRFQELSWDHTSPEEEESVLWLEFDGDNEGTPVNKLLKIYSKQAELM
SSLIEYCIELNQTSEPAASQENVSGTPSAAGAPPPPIQRPQLRRQGSVVCSRLQHLSTID
YVEEGQQIKRVKPKRTTSFFSRQLSMGQGSYTVVQPTDSLEQG
Download sequence
Identical sequences E2R8F5
XP_540860.2.84170 ENSCAFP00000020042 ENSCAFP00000020042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]