SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020531 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020531
Domain Number 1 Region: 336-438
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.72e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 65-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 147-201,228-243,271-283
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000154
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020531   Gene: ENSCAFG00000013922   Transcript: ENSCAFT00000022111
Sequence length 717
Comment pep:known chromosome:CanFam3.1:3:57008883:57120506:-1 gene:ENSCAFG00000013922 transcript:ENSCAFT00000022111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILCPPAFPPPQMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHSEDQSHLRESFQQVVKLKGQVLSVMYRLRTKSREWMLIRTSSFTF
QNPYSDEIEYVICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPASVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPPGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSGKTQSSPFGI
GTSHSYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQW
QSQHHGQQSGEQHPHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences F1PPH3
9615.ENSCAFP00000020531 ENSCAFP00000020531 ENSCAFP00000020531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]