SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020854 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020854
Domain Number 1 Region: 82-532
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.62e-96
Family Integrin alpha N-terminal domain 0.000000000000393
Further Details:      
 
Domain Number 2 Region: 824-1048
Classification Level Classification E-value
Superfamily Integrin domains 4.13e-54
Family Integrin domains 0.00032
Further Details:      
 
Domain Number 3 Region: 685-818
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-34
Family Integrin domains 0.00012
Further Details:      
 
Domain Number 4 Region: 532-684
Classification Level Classification E-value
Superfamily Integrin domains 3.35e-34
Family Integrin domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020854   Gene: ENSCAFG00000014145   Transcript: ENSCAFT00000022461
Sequence length 1085
Comment pep:known chromosome:CanFam3.1:9:19049508:19064467:1 gene:ENSCAFG00000014145 transcript:ENSCAFT00000022461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGPVALSSAYCSASEFQSDKKSLPVVETERKRRQLAHSCPGDCGRRKMARAVCPLNAL
WLLEWVQLFLGPGAIPLGWALNLDPVQLTFYTGPNGSHFGFSLDFYKDNHGRVAFVVGAP
RTLGRSQEETGGVFLCPWRAEGGQCTSLPFDLNDETRHIGSHTFQTFKSRQGLGASVVSW
NDNIVACAPWQHWNVLEKTEEAEKTPVGGCFVAQLRNGHRAEYSPCRANTMSSVYVKNRF
NQDKRYCEAGFSAAVTQAGVLVLGAPGGYFFLGLLVRTPIDNIISSYRPGTLLWHVSSQS
FTYDYSKPEYYDGYRGYSVAVGEFDGNLNTTEYVLGAPTWSCTLGAVEILNEYHQTLHRL
HGEQMASYFGHSIAVTDVNGDGRHDLLVGAPLFMESRADRKLAEVGRVYLFLQPRGHQAL
GAPSLLLTGTQLYGRFGSAIASLGDLDRDGYNDVAVAAPYGGPSSLGQVLVYLGQSEGLS
SRPSQILDSPFPAGSGFGFSLRGATDIDDNGYPDLLVGAYGASKVAVYRAQPVVVANVQL
LVQDSLNPAVKNCILPQTKTPVSCFNIQMCMGATGHNIPQQLPLNAELQLDRQKPRQGRR
VLLLNSQLASSTLHLDLGGRHSPICHTTTAFLRDEADFRDKLSPIVLSLNVSLQPGKDGV
APAIVLHGDTHVQEQTRIILDCGEDDLCVPQLQLTAIVMGSPLLIGADNVLELQMDAANE
GEGAYEAELAVHLPPGAHYMRAISNIEGFERLICNQKKENETKIVLCELGNPMKRNARIG
ITMLVSVENLEEAGEHVSFWLQIRSKNSQNPNSEAVLLDVPVRAEAHVKLRGNSFPASLV
VVAEEDNRENSSESWGPKVEHTYELHNNGPGTVSGLHLHLCFPGESQPSDLLYILDIQPE
GGLQCSPQPSINPFKLDWRQPTPSPSPTSPGYHKRERRQASLPGSSQPSGLQDPVLLSCK
SGPHTVVQCELQEMARGQRAMVKVLAFLQLPSLQQRPLDQFVLESQAWFNVSSLPYAVPS
LSLPSGETLVQTHLLRALEERDIPIWWVLVGVLGGLLLLMLLVLAMWKGGFFKRNRPPLE
EEEEE
Download sequence
Identical sequences F1PRU9
ENSCAFP00000020854 ENSCAFP00000020854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]