SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021184 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021184
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.09e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021184   Gene: ENSCAFG00000014351   Transcript: ENSCAFT00000022807
Sequence length 491
Comment pep:known chromosome:CanFam3.1:6:9123477:9143691:-1 gene:ENSCAFG00000014351 transcript:ENSCAFT00000022807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDI
TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTS
LIPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKGPAYTKGSASTPIQGSIPEGKPLRTLLG
DPVPSLSAAASASSQSICQSQPRTSQPRSSQPPPHSSIKKASTDLLADIGGDPFAAPQVA
PAFAAFPAFGGQTPSHGGFANFDAFGSSPGSSAFGSIPPAGQGPFQAQPTATASRMLTGS
YSFGSSQVTPFGASPLAPTSQPNSLPDMGSLLGPGVSAGGIPSSVFGVAGQVPALQSAPA
GGGGGSTGLAFGAFTNPFTVPATHPQLPSTNPFQPNGLATGSSFGMSSTGPGFPQTVPPT
RAFVSTFPPPVFPPQTSMTQQQNGSSFSDLGSAKLGQRQLSQPAGTSTNPFMTGSSSSPF
ASRPPTTNPFL
Download sequence
Identical sequences J9NUD1
ENSCAFP00000021184 ENSCAFP00000036769 XP_013969692.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]