SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021382 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021382
Domain Number 1 Region: 49-462
Classification Level Classification E-value
Superfamily Serpins 3.27e-137
Family Serpins 0.000000000000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021382   Gene: ENSCAFG00000014470   Transcript: ENSCAFT00000023017
Sequence length 465
Comment pep:known chromosome:CanFam3.1:7:25322844:25332962:1 gene:ENSCAFG00000014470 transcript:ENSCAFT00000023017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSNGIGMIAAGKRRTCLLSLLLIGLWGCVVCPWSPGEDICTAKPRDIPVNPMCIYRSPE
KKAVEDEGAEQKIPEATNRRVWELSRANSRFATAFYQHVADSKNDNDNIFLSPLSISTAF
AMTKLGACNNTLKQLMEVFKFDTISEKTSDQVHFFFAKLNCRLYRKANKSSELVSANRLF
GDKSLTFNETYQDISEAVYGAKLQPLDFKENAEQSRMIINKWVSNKTHGRITDVVPPDAI
DELTVLVLVNTIYFKGLWKSKFSPENTRKELFYKAGGESCSVSMMYQEGKFRYRRVAEGT
QVLELPFKGDDITMVLILPKPEKSLAKVEQELTPEVLQEWLDEMTETLLVVHMPCFRMED
SFSVKERLQDMGLVDLFNPEKSRLPGIVAEGRNDLFVSDAFHKAFLEVNEEGSEAAASTV
IGIAGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCDN
Download sequence
Identical sequences E2RES2
XP_537187.4.84170 ENSCAFP00000021382 ENSCAFP00000021382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]