SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021383 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021383
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-45
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000192
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000021383
Domain Number - Region: 192-319
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0734
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021383   Gene: ENSCAFG00000014475   Transcript: ENSCAFT00000023019
Sequence length 360
Comment pep:known chromosome:CanFam3.1:20:44180964:44187824:1 gene:ENSCAFG00000014475 transcript:ENSCAFT00000023019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALALAAHQVPPSPLVSANGPGDEKLFRSQSADVPGPAERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAV
AEPPSVSEKEGPGQSLEQLEALVQTKDQEIQTLKSQTGATREALDATEREEAQQKVQDLE
TRNAELEHQLRATERSLEEARAERERARAEVGRAAQLLDVRLFELSELREGLARLAEGTP
Download sequence
Identical sequences F1PEM6
XP_005632732.1.84170 XP_541929.2.84170 ENSCAFP00000021383 ENSCAFP00000021383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]