SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021577 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021577
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-28
Family Second domain of FERM 0.0028
Further Details:      
 
Domain Number 2 Region: 220-361
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-24
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 16-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-16
Family First domain of FERM 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021577   Gene: ENSCAFG00000014633   Transcript: ENSCAFT00000023235
Sequence length 614
Comment pep:novel chromosome:CanFam3.1:8:27915318:27990186:1 gene:ENSCAFG00000014633 transcript:ENSCAFT00000023235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKGIDQFGPPMIIHFRVQYYVENGRLISDRAA
RYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPAWVV
SKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDKREIEASLT
LGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIYYTGCPM
RSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDSLDLDVDQLEKRSRA
SGSSAGSVKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSGSAIHRKLKSCSSMT
SHGSSHTSGVESSGKDRLEEDSQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDML
MSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDI
RLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCVNIQDAFPVKRTSKYF
SLDLTHDEVPEFVV
Download sequence
Identical sequences E2RJD3
ENSCAFP00000021577 XP_864050.1.84170 ENSCAFP00000021577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]