SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021844 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021844
Domain Number 1 Region: 12-158
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-24
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 512-584
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000112
Family SH2 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021844   Gene: ENSCAFG00000014831   Transcript: ENSCAFT00000023528
Sequence length 593
Comment pep:known chromosome:CanFam3.1:3:61450995:61472168:-1 gene:ENSCAFG00000014831 transcript:ENSCAFT00000023528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGLRKPAPSPSTDKRRAMCWVSAISFMAAEEMHWPVPMKAIGAQNLLTMPGGVAKAG
YLHKKGGTQLQLLRWPLRFVIIHKRCIYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSN
NVFPFKIVHISKKHRTWFFSASSEDERKSWMALLRKEIGHFHEKKELSLDTSFSDSSSDT
DSFYGAVERPVDISLSSYPTDNEDYEHEDEDDSYMEPDSPEPVEPEDTLTHPPAYPPPPV
PTPRKPAFSDMPRAHSFASKGPSPLLPPPPPKRGLPDASLTSEDSKRDLLGLRRPEAGLR
VSVAPRRMSDPPVGHLPPVPSLRKPPCFHESASPSSEPRVPGHGTGSVSSSASMATTSSR
NCDKLKSFHLSPRGPPTPEPPPVPANKPRFLKMAEEAPSEEVVKPRLFVPSVAPRPPGLK
LPTPEAIAKPAVLPRSEKPPLPYLQRSPPDGQSFRSFSFEKPRRPSKADNAGGEDSDEDY
EKVPLPSSVFINTTESCEVERLFKATSPQGEPQDGLYCIRNSSTKSGKVLVVWDESSNKV
RNYRIFEKDSKFYLEGEVLFVSVGSLVEHYHTHVLPSHQSLLLQRPYGYTRPR
Download sequence
Identical sequences E2RJ40
ENSCAFP00000021844 ENSCAFP00000021844 XP_005618564.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]