SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023578 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023578
Domain Number 1 Region: 56-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-80
Family Protein kinases, catalytic subunit 0.00000203
Further Details:      
 
Domain Number 2 Region: 1031-1088
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 1104-1224
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000129
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Domain Number 4 Region: 1256-1508
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000209
Family Tricorn protease domain 2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023578   Gene: ENSCAFG00000015982   Transcript: ENSCAFT00000025392
Sequence length 1816
Comment pep:known chromosome:CanFam3.1:7:37994975:38080314:1 gene:ENSCAFG00000015982 transcript:ENSCAFT00000025392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWA
KPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFNGIDWDNIRNCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
GPASLDLDVSVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTADGP
LTASKDLEIKTLKEEIENLRKQIRESSHLEQQLEEANSVRRELDDAFRQIKAYEKQIRTL
QQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHV
RDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEAVAAEASKDRKLREQSEHYSKQLE
NELEGLKQKQISYSPGLCSIEHQQEISKLKTDLEKKSIFYEEELSKREGIHANEIKNLKK
ELHDSEGQQLALNKEIMILKDKLEKNRRESQSEREEFENEFKQQYEREKVLLTEENKKLT
SELDKLTTLYENVSMRNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
LASKMTEELEALRNSSLGARATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEEL
NKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTP
TDALDQFETDPVESTYVRNPNVKVNVQSRSTSPSTSSEAEPLKIVDSTPLPAHTPTLRKK
GCPGSTGFPAKRKTHQFFVKSFTTPTRCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKA
PTACPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDV
AEGKASQPSVVVSQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASDSRCS
VLMLAESESERNKWVGVLNELHKILKKSKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDH
ERIALGNEEGLFVVHITKDEIIRVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPISAL
DGRETDFYKLAETKGCQTITSGKVCHGALTCLCVAMKRQVLCYELFQSKTRHRKFKEIQV
PYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGSPYSMLHSNDHTLSFIAHQPMDAICAVEI
SSKEYLLCFNSIGIYTDCQGRRSRQQELMWPSNPSSCCYNAPYLSVYSENAVDIFDVNSM
EWIQTLPLKKVRPLNSEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNI
NNKRRFSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMP
GFPYPSPNHHSGLISSPINFEHIYHMTVNSAEKFLSPDSINPAYSPSLRSVPGTPSFMTL
RNPRPQESRTVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYN
AKWQPMPSPSEGSLSSGGMDQGSDAPARDYDGEDSDSPRHSTASNSSNLSSPPSPVSPRK
TKSLSLESTDRGTWDP
Download sequence
Identical sequences E2R1X7
ENSCAFP00000023578 XP_005622674.1.84170 ENSCAFP00000023581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]