SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024865 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024865
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000247
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000156
Family Eukaryotic type KH-domain (KH-domain type I) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024865   Gene: ENSCAFG00000016904   Transcript: ENSCAFT00000026761
Sequence length 616
Comment pep:known chromosome:CanFam3.1:7:41875921:41892746:1 gene:ENSCAFG00000016904 transcript:ENSCAFT00000026761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGSATHPGAGGRRSKWDQPAPAPLLFLPPAAPGAEVPSSGGSPGGSAAAPSGALDAAA
AVAAKINAMLMAKGKLKPTQNVAEKLQAAGKGLTSSKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTSEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAVNQKPPFQSGMHYVQDKLFVGLE
HAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHP
KPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAISSVPPQPPYYPSNGY
QSGYPVVPPPQQPLQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPAGT
GQSPMSGPFIPAAPVKTALPAGPQPQPPPPPQPPLPAQPQAQKRRFTEELPDERESGLLG
YQHGPIHMTNLGTGFSSQNEIEGAGSKPAGSSGKERERDRQLMPPPAFPVTGMKAESDDR
NGSGAGAGSHDYPVKKMKTAEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYP
SSQPRAKQQMPFWMAP
Download sequence
Identical sequences E2RTC6
ENSCAFP00000024865 9615.ENSCAFP00000024865 ENSCAFP00000024865 XP_851894.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]