SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025283 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025283
Domain Number 1 Region: 1066-1403
Classification Level Classification E-value
Superfamily NHL repeat 1.33e-24
Family NHL repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 761-836
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000922
Family Pre-dockerin domain 0.057
Further Details:      
 
Domain Number 3 Region: 1299-1346,1374-1392,1419-1532
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000282
Family YVTN repeat 0.048
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000025283
Domain Number - Region: 514-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000562
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 611-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00156
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 581-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00227
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 447-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00347
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 482-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00431
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 637-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00712
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 417-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0538
Family EGF-type module 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025283   Gene: ENSCAFG00000017137   Transcript: ENSCAFT00000027184
Sequence length 2603
Comment pep:novel chromosome:CanFam3.1:4:43449809:43871097:-1 gene:ENSCAFG00000017137 transcript:ENSCAFT00000027184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLQNGRPIPPTSSSSLLPSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNS
YLLRACSGPQQASSSGPPNHHSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQI
HAPAPAPNDLATTPESVQLQDSWVLNSNVPLETRHFLFKTSSGSTPLFSSSSPGYPLTSG
TVYTPPPRLLPRNTFSRKAFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIAMHLLGL
NWQLQPADGHTFNNGIRTGLPGNDDVATMPSGGKVPWSLKNSSIDSGEAEVGRRVTQEVP
PGVFWRSQIHISQPQFLKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVE
SPRERRSIQTLVQNEAVFVQYLDVGLWHLAFYNDGKDKEMVSFNTVVLDSVQDCPRNCHG
NGECVSGLCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCID
PSCGGHGSCIDGNCVCSAGYKGEHCEEVDCLDPTCSSHGVCVNGECLCSPGWGGLNCELA
RVQCPDQCSGHGTYVPDTGLCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTG
AACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIDGCPDLCNGNGRCTLGQNSWQCVC
QTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQ
GQTDSPAVKSFYDRIKLLAGKDSTHIIPGDNPFNSSLVSLIRGQVVTTDGTPLVGVNVSF
VKYPKYGYTITRQDGTFDLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKT
EENSIPSCDLSGFVRPDPIIISSPLSTFFSAAPGHNPIVPETQVLHEEIELPGSNVKLRY
LSSRTAGYKSLLKITMTQSTVPLNLIKVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDA
YGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILNVKS
GILHKGTGENQFLTQQPAIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSL
FVGDFNYIRRIFPSRNVTSILELRNKEFKHSNNPAHKYYLAVDPVSGSLYVSDTNSRRIY
RVKSLSGAKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYF
VDATMIRKVDQNGIISTLLGSNDLTAVRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYV
LENNVILRITENHQVSIIAGRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYIT
ETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAV
APDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTG
EYLYNFTYSADNDVTELIDNNGNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVS
TQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSI
TIDIENSNRDDDVTVITNLSSVEASYTVVQDQVRNSYQLCNNGTLRVMYANGMGVSFHSE
PHVLAGTITPTIGRCNISLPMENGLNSIEWRLRKEQIKGKVTIFGRKLRVHGRNLLSIDY
DRNIRTEKIYDDHRKFTLRIIYDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSE
RTDIDKQGRIVSRMFADGKVWSYSYLDKSMVLLLQSQRQYIFEYDSSDRLHAVTMPSVAR
HSMSTHTSIGYIRNIYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEI
VYDSTAVTFGYDETTGVLKMVSLQSGGFSCTIRYRKIGPLVDKQIYRFSEEGMVNARFDY
TYHDNSFRIASIKPVISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLS
KHFDTHGRIKEVQYEMFRSLMYWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQL
QSVAVNDRPTWRYSYDLNGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLC
QRGADIFEYNSKGLLTRAYNKASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTR
ITHVYNHSNSEITSLYYDLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQY
TAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWKNVGKE
PAPFNLYMFKSNNPLSNELDLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYEL
SESQASENGQLITGVQQTTERHNQAFMALEGQVISKKLHANIREKAGHWFATTTPIIGKG
IMFAIKEGQVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGSADGDL
VTLGTTIGRKVLESGVNVTVSQPTLLVNGRTRRFTNIEFQYSTLLLSIRYGLTPDTLDEE
KARVLDQARQRALGTAWAKEQQKARDGREGIRLWTEGEKQQLLSTGRVQGYEGYYVLPVE
QYPELADSSSNIQFLRQNEMGKR
Download sequence
Identical sequences F1PQB7
ENSCAFP00000025283 ENSCAFP00000025283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]