SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025624 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025624
Domain Number 1 Region: 451-629
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-49
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-18
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 142-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000259
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025624   Gene: ENSCAFG00000017390   Transcript: ENSCAFT00000027553
Sequence length 631
Comment pep:novel chromosome:CanFam3.1:9:31703287:31725704:-1 gene:ENSCAFG00000017390 transcript:ENSCAFT00000027553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVPLAEELSCSVCLEPFKGPVTTPCGHNFCGACLDETWAVQGPPYLCPQCRAVYQAR
PQLHKNTVLCAVVEQLLQAGAAPQPPDGGTPAAPAKTGPVACDHCLKAPAVKTCMVCMAS
FCQEHLQPHLDSPAFQDHQLQPPVKDLLRRKCAEHNRLRDFFCPQHDECICYICLIEHKA
CSPASLSQASADLETKLKHKLTVIYDQISGASRALEDVRTRQQDVQETASQKMKQLRQEC
MEIKALIDGTEAISIQKIRDEEKRVSTKLGNIYQILLKKKSEIQTLKEEVELALIKQDEF
EFLEKAKKLQGISTKPVYVPKVDLNQELIKGICQGTSNLKERLKHYIRQSQDQKAEEPTS
SGNPGEHGSASTHKPIHFAKKLPKEEKKTKKPATASGSASSVKMPTFGAPEQLLDLKQAS
PETGAKATSEQQNVVSLKAKVLENFLLKSRPELLEYAVKFSLDYNTAHNKVALLENYTVA
SVADLPLNYQPHPKRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMPRQGPE
SRLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFGVSDKVHL
MYKYRVDFTEALYPAFWVFSAGAMLSICSYK
Download sequence
Identical sequences F1PTE2
XP_548223.3.84170 ENSCAFP00000025624 ENSCAFP00000025624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]