SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026884 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026884
Domain Number 1 Region: 274-348
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000432
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 72-147
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000122
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 909-988
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000051
Family Carboxypeptidase regulatory domain 0.036
Further Details:      
 
Domain Number 4 Region: 828-899
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000128
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000026884
Domain Number - Region: 387-439
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000902
Family Carboxypeptidase regulatory domain 0.019
Further Details:      
 
Domain Number - Region: 160-243
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00216
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 755-813
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00824
Family Cna protein B-type domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026884   Gene: ENSCAFG00000018181   Transcript: ENSCAFT00000028906
Sequence length 1178
Comment pep:known chromosome:CanFam3.1:6:27738221:27793390:-1 gene:ENSCAFG00000018181 transcript:ENSCAFT00000028906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKLYTKHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTIVELYVDGVSDI
CTKGGDIDFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFK
VLPGDYEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKF
LLFSSVVSKEDVLGCNISPVPGFQPPDESLVYLCYAVSKEDGSFSFYSLPSGDYTVIPFY
RGERITFDVAPSRRDFAVEHDSLKIEPVFHVMGFSVTGRVLNGPEGEGVPEAVVTLNNQI
KVKTKADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQIS
IIRFPDTVKQMSKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRA
GLTLKPQTFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQ
LSGRVNSMTFTFDTVLPGKYKISIMHEDWCWKNKSLEVEVLEEDVSTIEFRQTGYMLRCS
LSHAITLEFYQDGNGPENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSS
PSILTLTAIRHHVLGTITTDKMLDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIE
SRRQEREKSGKEDAGEGRTKPPVQEMVEELQGPFSYDFSYWARSGEKITVTPSSKELLFY
PPSMEATVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDR
GAYSVGPLHSDLEYTVSSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLL
SLSGGVFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQSLKITVT
GYRTAYSCYGTVSSLNGEPEQGVAVEAVGQDDCSIYGEDTVTDEEGKFRLRGLLPGCVYH
VQLKAEGNDHIERALPHHRVIVVGNNDIDDVSIIVFRQINQFDLSGNVITSSEYLPTLWV
KLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGQNYVVLLDSTLPRSQYDYVLPQVSFTAV
GYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVR
ALGQTASDNSGPEDAKRQAKKQKTRRTLKIIYYYYFCQ
Download sequence
Identical sequences F1PB46
ENSCAFP00000026884 ENSCAFP00000026884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]