SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027005 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027005
Domain Number 1 Region: 25-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-45
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 256-450
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-37
Family BAR domain 0.012
Further Details:      
 
Domain Number 3 Region: 591-672
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-21
Family SH3-domain 0.00063
Further Details:      
 
Domain Number 4 Region: 495-569
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000748
Family SH3-domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027005   Gene: ENSCAFG00000018281   Transcript: ENSCAFT00000029042
Sequence length 675
Comment pep:known chromosome:CanFam3.1:4:59357833:59412617:-1 gene:ENSCAFG00000018281 transcript:ENSCAFT00000029042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHGTDEPSSRTGSPDGECQVLEDRSLLHQRLAVRELIDTEVSYLHMLQLCASDIRSRL
QQLPQGDLDVLFSNIDDVIEVNNRFLHDLQETESREEEQVHLIGNLFLKFQEELERVYKV
YCASYDQALLLVEAYRKEPELQREIQGIIETVVPQAGPSGLSFLLVIPLQRITKYPLLLQ
KILENTVPDASAYPVLQRAASALQDVNTNINEYKRRKEVASKYTKVEQLTLRERLARLNT
HTLSKKTTRLSQLLKQEAGLVPKTEDKEFDDLEERFHWVSLCVTEMKNNMAVYLDNLEAF
LRFRPQEYDLDIPGGPVVQYCSLMRELQLQAFPQFKQRLEGLVWQPLCSLAKALAGPQNL
IKKRLDKLLDFERVEEKLLEAGSVTYEEQEARHTYQALNSLLVAELPQLNQLAMHWLGQI
LCTFVGLQRDLAKHVLQRAEGSLAQLPHSHLSEPAFRKLVEDTLGQTGHQLRSFRENLDK
VLPPPATQPLLPGAERQVQALLSRYGPEKLYQVTSNISGAGTLDLTLPRGQIVALLQNKD
TKGNSSRWLVDTGGHRGYVPAGKLELYRVTPSQEEVRGQEWPHKDSRHLTPEPTPAPVSS
VPVVTQVVAVYPFVARSSHEVSLQAGQLVTVLEAQDKKGNPEWSLVEVNGQRGYVPSSFL
ARAPSPAPWGWSLPS
Download sequence
Identical sequences F1PUV5
ENSCAFP00000027005 ENSCAFP00000027005 XP_005619364.1.84170 XP_005619365.1.84170 XP_546309.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]