SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028151 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028151
Domain Number 1 Region: 1-593
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.79e-211
Family Motor proteins 0.0000000024
Further Details:      
 
Domain Number 2 Region: 1000-1097
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-28
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1180-1299
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-22
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 4 Region: 1583-1652,1695-1739
Classification Level Classification E-value
Superfamily Second domain of FERM 2.21e-17
Family Second domain of FERM 0.0075
Further Details:      
 
Domain Number 5 Region: 1117-1172
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000176
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 914-1001
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000931
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000028151
Domain Number - Region: 612-718,1003-1028
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00439
Family BAR domain 0.079
Further Details:      
 
Domain Number - Region: 1490-1576
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0148
Family Ras-binding domain, RBD 0.035
Further Details:      
 
Domain Number - Region: 1743-1829
Classification Level Classification E-value
Superfamily PH domain-like 0.0615
Family Third domain of FERM 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028151   Gene: ENSCAFG00000019081   Transcript: ENSCAFT00000030300
Sequence length 1847
Comment pep:novel chromosome:CanFam3.1:4:86703260:86793553:1 gene:ENSCAFG00000019081 transcript:ENSCAFT00000030300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRIVDYLLEKNRVVRQNPGERNYHIF
YALLAGLQHEQREEFYLSVPENYHYLSQSGCIGDKTISDQESFREVITAMEVMEFSKEEV
REVLRLLAGVLHLGNIEFITAGGAQVSFKTALGRSAELLGLDSAQLTDALTQRSMFLRGE
EILTPLTVQQAEDSRDSLAMALYARCFEWVIKKINSRIKGKDDFKSIGILDIFGFENFEV
NHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWIDNGECLDLIEKKLGLL
ALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVAVNNFGVKHYAGEVQYDVRGILEK
NRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTLKCGSKHRRPTVSSQFKDSLHSLM
ATLSSSNPFFVRCIKPNTQKMPDQFDQAVVLNQLRYSGMLETVRIRKAGYAVRRPFQDFY
KRYKVLMRNAAVPDDIRGKCTALLQLYDSSNSEWQLGKTKVFLRESLEQKLEKQREEEVT
RAAMVIRAHVLGYLARKQYRKVLYCVVIIQKNYRAFLLRRRFLHLRKAAIVFQKRLRGQI
ARRIYRQLLEEKRAEEEKRKWEEEERERERARREAELRTQQEEAARRQQELEALQKSQRA
AELHCDLEKQKENKQVEEILRLEKEIEDLQRMKERQELSLTEASLQKLQQLRDEELRRLE
DEACRAAQEFLESLNFDEIDECVRHIERSLSAGGEALGAEAPGAEGAEGAVAQRPSFNFS
QPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDESSEEDPYMNDTVVPVSP
SADGSLLLGPSEPISVAGEPAYCMPQGGGALPSADGHYDYDRDDYEDGAATSGSSVTFST
SYGSQWSPDYRCSVGTYNSSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYS
CVTLPYFHSFLYMKGGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSR
RNWKKRWFVLRQSKLMYFENDSEEKLKGTLEVRAAREIIDNTSKENGIDIIMADRTFHLI
AESPEDASQWFSVLSQVHASTDQEIREMHDEQANPQNAVGTLDVGLIDSVCASDSPERPN
SFVIITANRVLHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLHKEGKNSPKMSS
LKLKKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNITVYGR
KHCYRLYTKLLNEATRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNP
ILRHTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQG
ILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLCSWQILTCLSCTFLPSRGILKYLRF
HLRRIREQFPGTEMEKYSLFIYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGS
CKITINSHTTAGEVVEKLIRGLAMEDSRNMFSLFEYNGSVDKAIESRTIVADVLAKFEKL
AATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIRGHYPAPEENLQVLA
ALRLQYLQGDYSPHASLPPLEDVYSLQRLKARISQATKTFTPCERLEKRRTSFLEGTLRR
SFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIVDKWKKLQGVGQEQAMAKYMALIKEWP
GYGSTLFDVECREGGFPQDLWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYK
IVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTSRSVSSQGSSR
Download sequence
Identical sequences F1Q2W2
ENSCAFP00000028151 XP_013968636.1.84170 ENSCAFP00000028151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]