SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028160 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028160
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-81
Family BAR domain 0.0000000188
Further Details:      
 
Domain Number 2 Region: 295-344
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000289
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028160   Gene: ENSCAFG00000019083   Transcript: ENSCAFT00000030309
Sequence length 389
Comment pep:known chromosome:CanFam3.1:20:55278876:55315387:1 gene:ENSCAFG00000019083 transcript:ENSCAFT00000030309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDEDFKEMEKKVDVTSKAVTEVLARTIEYLQP
NPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGRIPD
EELRQALEKFEESKEVAETSMHNLLETDIEQVSQLCALVDAQLDYHRQAVQILDELADKL
KRRMRDASSRPKREYKPKPREPFDLGEPEQSNGGFPCATAPKIPASSSFRSSDKPIRTPS
RSMPPLDQPSCKALYDFEPENAGELGFHEGDVITLTNQIDENWVPHPRQAHGTFLWHELP
PPAVHTALTCAPQTGPQESSSLCSAEGQI
Download sequence
Identical sequences E2R273
ENSCAFP00000028160 ENSCAFP00000028160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]