SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028310 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028310
Domain Number 1 Region: 213-358
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-47
Family Phosphotyrosine-binding domain (PTB) 0.00000263
Further Details:      
 
Domain Number 2 Region: 383-494
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-18
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 3 Region: 487-556
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000158
Family PDZ domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028310   Gene: ENSCAFG00000019193   Transcript: ENSCAFT00000030470
Sequence length 623
Comment pep:novel chromosome:CanFam3.1:20:55713800:55720389:1 gene:ENSCAFG00000019193 transcript:ENSCAFT00000030470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLTASQSPSAPPAMDLEDPRDTLSPSQDLTPTCQWDPVPASSGSLSQMELDGPSVQDL
VQQFEALPGDLVGLSPDGRPCPLHVATGHGLASQDVADAHGLLSAEAGREDLLSLLQCQE
CPPSQPCPKEPPDPAPRLLQPPEDPDGDTSAPEWAEGASAEQGGSRSSSSSPEPWLETVP
LVAPEEPPASAQSPKTLVPYPALQEVPGPCDHEDLLDGVIFGAKYLGSTQLVSERNPPPS
TRMAQAREAMDRVKAPDGETQPMTEVDLFVSTKRVKVLTADSQEAMMDHALQTISYTADI
GSVLVLMARRRLARRPASQTRSRRLYKMLCHVFHSEDAQLIAQAIGQAFAAAYSQFLRES
GIDPSQVGAPQSQGAAGPGHLHNGDLDHFSNSENCREVCIEKRRGEGLGVALVESGWGSL
LPTAVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVREVKSQTLVTLSI
IHCPPVTTAIIRRPHAREQLGFCVEDGIICSLLRGGIAERGGVRVGHRIIEINGQSVVAT
PHARIIELLTEAHTEVRGGGRVRGGGPCSCQRRSPGTTGPPLCSPRSTSKPCRPPPTACS
QARSSPCTCDRPPAPLPPPPVVP
Download sequence
Identical sequences J9NW46
ENSCAFP00000028310 ENSCAFP00000037390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]