SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029561 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029561
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily EF-hand 3.68e-43
Family Calmodulin-like 0.0000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029561   Gene: ENSCAFG00000019953   Transcript: ENSCAFT00000031749
Sequence length 160
Comment pep:known chromosome:CanFam3.1:9:53672017:53676808:-1 gene:ENSCAFG00000019953 transcript:ENSCAFT00000031749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALS
VTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVD
RIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Download sequence
Identical sequences A0A091H5H0 D2H171 F1MZQ0 F1PET6 F6WGJ6 G1N134 G9KCV0 H0XKR7 L5K7C3
ENSPVAP00000003345 9615.ENSCAFP00000029561 9823.ENSSSCP00000006103 9823.ENSSSCP00000006105 ENSMGAP00000005178 ENSPVAP00000003345 ENSMGAP00000005178 ENSBTAP00000011496 ENSSSCP00000006105 ENSSSCP00000006105 ENSCAFP00000029561 ENSBTAP00000011496 ENSOGAP00000016707 ENSCAFP00000029561 ENSOGAP00000016707 ENSCJAP00000037900 XP_010135997.1.100080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]