SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037232 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037232
Domain Number 1 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 49-108
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-22
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 4 Region: 421-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-20
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 658-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 616-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 523-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000102
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 9 Region: 318-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000531
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 255-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000141
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037232   Gene: ENSCAFG00000029814   Transcript: ENSCAFT00000043848
Sequence length 720
Comment pep:known chromosome:CanFam3.1:1:105501093:105522789:-1 gene:ENSCAFG00000029814 transcript:ENSCAFT00000043848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTELQDPEKSGAVSKRNREVKHRGDMPAKENWPQRSQVLSPQEQDGPCEGSVSFEDVTM
DFSREEWQQLDPAQRCLYQDVMLEIYSHLLFVGYNIPNPEIISRMEKGEEPWMREIQLPH
QRHRERAFGLKTSQHKMFEKFLFHNEVIRDSSWCCISEDLREDASRAVRNQQKQNNPAQH
GAFLNRKTLDTGRDCECKNPRKIIHLKPYLVSSQKRSHKHCSFAKSLKPNLEVNHQNQSD
STKHLNELVGPGHLFTHSSSSAGCKHIHPGENFCEGNQCTKDLSHKQSHSQHQIRNQEKP
DKCAECGRGFPQKPPLEQQRFHSVENLQECGKCTKGFTPQPKLGVYLTNHTSSIPYICKE
CGKVFIQRSELISHQKTHTRKKPHKCHECGKAFFQMLSLFRHQRTHSSEKLYECSECGKG
FSQNSTLTIHQKIHTGERQYTCGECGKAFTQKSTLSLHQRIHSGEKSYVCIECGQAFVQK
AHLTVHQRGHTGEKPYPCHSCGKSFISKSQLDIHHRIHTGEKPYECSDCGKAFTQKSHLN
IHQKIHTGERQHVCRDCGKAFNQKSILSMHQRTHTGEKPYKCSDCGKAFTSKSQFKEHQR
IHTGEKPYVCSDCGKAFNGRSNFHKHQMTHMREKTFACYKCGNAFVQKSELMAHQRTHVG
EKPYECCDCGKSFSKKPQLQVHQRIHTGEMPYVCSQCGKAFNNRSNFNKHQTTHTRGRSY
Download sequence
Identical sequences J9NVP0
ENSCAFP00000037232 ENSCAFP00000037232 XP_003432694.3.84170 XP_013970407.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]