SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037638 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037638
Domain Number 1 Region: 348-617
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.97e-89
Family Eukaryotic proteases 0.00000000151
Further Details:      
 
Domain Number 2 Region: 104-192
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-31
Family Kringle modules 0.00000943
Further Details:      
 
Domain Number 3 Region: 209-295
Classification Level Classification E-value
Superfamily Kringle-like 1.16e-26
Family Kringle modules 0.0000109
Further Details:      
 
Domain Number 4 Region: 43-100
Classification Level Classification E-value
Superfamily GLA-domain 6.73e-19
Family GLA-domain 0.0000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037638   Gene: ENSCAFG00000009122   Transcript: ENSCAFT00000045274
Sequence length 621
Comment pep:known chromosome:CanFam3.1:18:42782867:42799970:-1 gene:ENSCAFG00000009122 transcript:ENSCAFT00000045274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHIRGLWLPGCLVILFSLAHSQHVFLDPQQALSLLHRVRRANSGFLEELRKGNLERECV
EEQCNYEEAFEALESSTATDVFWSKYTACEPVRKPREKLVECLEGSCAEGLGMNYRGNVS
FTRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDGSTTGPWCYTIDPTVRREEC
SISLCGQQGGVTVPLTPRSGGPTVNLSPPSEHCIPERGRYYQGRLAVTTHGSPCLAWASR
QAKALSKDQDFNPAVPLVENFCRNPDGDEEGAWCYVSEEPGGFEYCDLDYCEEPVEEVGD
GLAEDQDTAIEGRTTAEEFQPFFNEKTFGAGEADCGLRPLFEKRSVKDKTEGELLESYID
GRIVEGWDAEIGLAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEND
LLVRIGKHSRTRYERSIEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPVNFSNYIHPV
CLPDRDTATRLLQAGYKGRVTGWGNLRETWTSSIGEVQPRVLQVVNLPIVDRQVCKASTR
IRITDNMFCAGYKPNEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYG
FYTHVFRLKKWIQKVIEKSGG
Download sequence
Identical sequences J9NSF9
XP_003639742.1.84170 ENSCAFP00000037638 ENSCAFP00000037638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]