SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040134 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040134
Domain Number 1 Region: 40-180
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000632
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040134   Gene: ENSCAFG00000030640   Transcript: ENSCAFT00000045439
Sequence length 203
Comment pep:known chromosome:CanFam3.1:25:41421210:41547896:-1 gene:ENSCAFG00000030640 transcript:ENSCAFT00000045439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVPTTGMQFL
SGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIA
YCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFKKTFHSMK
SDGRIHRNSSSEEVSQELESDDG
Download sequence
Identical sequences J9P3K5
ENSCAFP00000040134 ENSCAFP00000040134 XP_008688614.1.72690 XP_019512661.1.44202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]