SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040214 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040214
Domain Number 1 Region: 359-459
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.33e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 96-164
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.45e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 180-234,262-277
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000572
Family BphP N-terminal domain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040214   Gene: ENSCAFG00000011089   Transcript: ENSCAFT00000046810
Sequence length 624
Comment pep:novel chromosome:CanFam3.1:27:20302428:20379914:-1 gene:ENSCAFG00000011089 transcript:ENSCAFT00000046810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RILIDENQCISPVISSHMSQWTKPTALGSLSPHVIEFPRKRKGSDSDPSQSGIMTEKMVE
KLSKNPFTYLLSTRIEISASSGSRMEDGEQQVKMNQLREAHSQTEKRRRDKMNNLIEELS
AMIPQCNPVPRKLDKLTVLRMAVQHLKSLKGMTSSYAGDNYRPSFIQDNELRHLILKTAE
GFLFVVGCERGKILFVSKSVSKILNYDQASLTGRSLFDFLHPKDVAKVKEQLSSSDISPR
EKLIDAKTGLQVHGNFHSGRTHVYSGSRRSFFCRMKSCKISVKEEHECLSTSKKKDHRKF
CTIHCTGYLRSWPPNIVGLEEERDNKKNSSNFTCLVAIGRLHPYIVPQNSGEIKVKPTEF
ITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSNLTDKHKAVLQSKEKIF
TDSYKFRKKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEMREVSLLPCSSQSS
EESSKQSCISVPGMSAGIVLGAGSIGTDIVNEVLDLQRLQSPSLDDSSPTDLMKDSCAIN
SRKTSKKELIPLNSSEIGKSEATRRNQSAVPPHSHEPLLGENAQLDFDALCDNDDTAMAA
FMNYFEAEGGLGDPGDFSDIHWTL
Download sequence
Identical sequences F1PZY3
ENSCAFP00000016353 ENSCAFP00000040214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]