SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041248 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041248
Domain Number 1 Region: 308-394
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000128
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 147-199
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000969
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 46-98
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000114
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041248   Gene: ENSCAFG00000032405   Transcript: ENSCAFT00000047187
Sequence length 594
Comment pep:novel chromosome:CanFam3.1:1:108918629:108935682:-1 gene:ENSCAFG00000032405 transcript:ENSCAFT00000047187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPYPGGGGGGGELKCGAGRGRSVPWDFLPGLVVKAPPGPCVQAQRKEKSRNAARSRRG
KKNLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRATGPPAGL
APGHRGPMALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTG
SSVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVPSSSSSSSSSSLADTPEIEASAAEAP
PFSRVQERSFFIRMKSTLTKRGLHVKASGYKVIHVTGRLRARSLGLVALGHTLPPAPLAE
LPLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDAARIRQSHLDL
LDKGQVMTGYYRWLQRAGGFVWLQSVATVAVSGKSPGERHVLWVSYVLSQAEGGQTPLDA
FQLPASVACEDISSPEPEPTEPEPPAEGKQAAPLDKDEAPRSRGKRIKVEPGPGEAKDPE
DSGDEEPSSHPALPRPEFTSVIRAGALKQDLVRPWGLGPPGDPPPSLLHASFLPPVVRGL
CTPGAIRYGPAELGLMYPHLQRLGPGPTLPEAFYPTLGLSYPGPTGTRVQRKGD
Download sequence
Identical sequences J9P6G5
XP_541539.2.84170 ENSCAFP00000041248 ENSCAFP00000041248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]