SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041766 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041766
Domain Number 1 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 549-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 39-100
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.29e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 384-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 593-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 234-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000112
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000041766
Domain Number - Region: 317-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000283
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041766   Gene: ENSCAFG00000029119   Transcript: ENSCAFT00000046156
Sequence length 680
Comment pep:novel chromosome:CanFam3.1:1:70171430:70176078:1 gene:ENSCAFG00000029119 transcript:ENSCAFT00000046156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHPGALFICFKFFTVKLRIVFMSMSPNFEPFRLNRSVLLQASISFKDVTVEFTQEEWQQ
MGPIQRTLYRDVMLENYNNLVSVGNCIFKPAVIFKLEQGEEPWLLEEEFSNQSHLEDYRD
DDLMKRNKKIKDKHLQEIIFINNKPLTGEEEEVWGKQFNLHIAPVSTKMSHKYDSWGVNL
QKISQFVINSRTYLTKKTNCYSVCENLSFKIKFERTHTGEEFHEYNKNGKALSYKENLPE
NQKCQTLEQAFKYNAIGKAFYDEATCVTHKSIHTREKSYKDDECRENKKTTIFDCKRTGI
EEKYSPFNQYGKSICEKSALKEYSKFNMAVKQNECNASGNNFNRKSHLTQFQRIITEENP
LVCNDRTQTEDKSSEYHKSRKSYQISAHKVHQRTHSEIKPYKCKECGKSFFQKGHLIQHQ
RTHTGEKPFECNECGKTFSQKSHLSTHRRIHTAEKPYKCNECGKTFVQKSTLRGHQRIHT
GEKPYKCSECGKTFVQKSTLRDHHRIHTGEKSFQCKECGKTFGQKSNLRIHQRTHSGEKT
YQCNECEKSFWRKDHLIQHQKTHTGEKPFKCNECGKTFARTSTLRVHQRIHTGEKPFKCN
ECGKKFVRKAILSDHQRIHTGEKPFQCNKCAKTFGQKSNLRIHQRIHNGEKSYEGNEFGK
LYKKSTLNVCQRIQGGGKPH
Download sequence
Identical sequences J9P7X7
ENSCAFP00000041766 ENSCAFP00000041766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]