SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71908873|ref|YP_286460.1| from Dechloromonas aromatica RCB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71908873|ref|YP_286460.1|
Domain Number 1 Region: 110-520
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 6.54e-81
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000695
Further Details:      
 
Domain Number 2 Region: 10-103
Classification Level Classification E-value
Superfamily Cytochrome c 1.69e-16
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71908873|ref|YP_286460.1|
Sequence length 528
Comment cytochrome d1, heme region [Dechloromonas aromatica RCB]
Sequence
MNLRSIGKILIPAGFAAYFLFGMAQLAEAADVVANFKQHCAACHGVDRLGGIGPALLPDN
LARLRKPEAEKVIREGRPATQMLGFGQQLNNEEIKALVEYAYTPITPMPVWGEKEIKASR
IVNFAPGSLPDKPQFKADPLNLFVVVESGDHHVSILDGDKLEPIYRFQSRFALHGGPKFT
PDGRYVFFASRDGWITKFDMWNLKVVAEVRAGINTRNAAVSGDGKWVAVANYLPHSLVIL
DAELNMAKILPVADKDGKVSSRVSAVYDASPRQSFVAALKDVKEVWEISYNPKADAIPAG
MIHDYKYQEGAFIPGFLNPQRTQLDDYLDDFFFTQGYDELMGASRNDSKSVVSGQVVNLD
ARKKIADLQLPGMPHLGSGISWQWQGKTVMATPNLNEGLISIIDMKTWQTIKQIKTRGPG
FFMRSHENSRYAWTDSMMSKEFKDTMQIIDKEKLEIVAELKPEPGKTFAHVEFTRDGKYV
LASLWEMDGALIIYDAETLKEVKRLPMKKPVGKYNVWNKITKSEGTSH
Download sequence
Identical sequences Q47AZ1
WP_011288986.1.67134 159087.Daro_3260 gi|71908873|ref|YP_286460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]