SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71908887|ref|YP_286474.1| from Dechloromonas aromatica RCB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71908887|ref|YP_286474.1|
Domain Number 1 Region: 132-561
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 4.32e-118
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000000000146
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily Cytochrome c 6.3e-19
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71908887|ref|YP_286474.1|
Sequence length 561
Comment cytochrome d1, heme region [Dechloromonas aromatica RCB]
Sequence
MKKNVVGMLALSAMAFAMGSAFAQETAKAAPEMTAAEKEQAKKIYFERCAGCHGVLRKGA
TGKNLEPHWTKKDKDGNVTEGGTLKLGQQRLEKIIGYGTDGGMVNFDDILTKEELTLMAK
YIQNTPDVPPEYSFKDTMDSWKVMVPVDKRPTKQMNKYNLKNMFSVTLRDTGEVALIDGD
TKEIRSIVKTGYAVHISRLSASGRYVYVIGRDGRLSLIDLWMEQPAVVAEVKIGFDARSV
DTSKFKGFEDKYAVAGSYWPPQYVIMDGDTLKPRKVVSTRGMTVDGEYHPEPRVASIVAS
FTKPEWVINIKETGQILLVDYSDIENLKTTTIGSAKFLHDGGWDASKRYFLVAANASNKI
AAVDTKTGKLAALVDVAKIPHPGRGANFTHPKFGPVWTTGHLGADVLTLISTPSDKKSDA
KFKEYNWKVVQEVKHVPGNLFVKTHPKSKHLWADSPQNPEKELAESVAIWDVADLSKPVK
VINVAKDSGLPVTKATRRAVHPEYSADGKEVWISLWGGKTDQSAIVVYDDATLTLKKVIT
DPKMITPTGKFNVFNTQHDIY
Download sequence
Identical sequences Q47AX7
WP_011289000.1.67134 gi|71908887|ref|YP_286474.1| 159087.Daro_3274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]