SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71908935|ref|YP_286522.1| from Dechloromonas aromatica RCB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71908935|ref|YP_286522.1|
Domain Number 1 Region: 151-576
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 8.89e-126
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000000899
Further Details:      
 
Domain Number 2 Region: 48-166
Classification Level Classification E-value
Superfamily Cytochrome c 1.25e-21
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71908935|ref|YP_286522.1|
Sequence length 576
Comment cytochrome c, class I:cytochrome d1, heme region [Dechloromonas aromatica RCB]
Sequence
MISRKFKRSGLAALPLLAMLVQFAFAGTPSEHGDGAMRDYQAAGGSPLADVKMHQDINPL
APKMSETEFDKAKRIFFERCAGCHGVLRKGATGKPLTPDITLGKGLEYLKVFIKYGSAGG
MPNWGTSGILTDDEVDLMARYIQQTPPAPPEFGLKDMEASWKVIVPVDQRPKRKMNNINL
ENMFSVTLRDAGEIALIDGDSKKIISILNTGYAVHISRMSASGRYMFVIGRDAKINLIDL
WMEKPDTVAEIKVGMEARSVESSKAKGFEDKYAIAGTYWPPQFVIMDGDTLKPRKIVATR
GMTVGTQDYHPEPRVAAIVSSHFNPEFFVNVKETGMVYSVDYRDLNNLKIKMIEAAPFLH
DGGFESTHRYFMDAANASNKIAVIDTKEGKLEKLVPVGKTPHPGRGANFIDPKFGPVWAT
GHLGDESITLIGTDPKKHPDNAWKVVRTLKGLGGGSLFLKTHPKSKNLWVDTTLNPEAGI
SQSVAVWDINNLEKGSELIPIGEWSGIKDGPKRVVQPEYNKAGDEVWFSVWNGKDQESAI
VVVDDKTRKLKAVIRDPKLVTPTGKFNVFNTQHDVY
Download sequence
Identical sequences Q47AS9
159087.Daro_3323 WP_011289048.1.67134 gi|71908935|ref|YP_286522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]