SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0113290 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0113290
Domain Number 1 Region: 601-689
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-20
Family Third domain of FERM 0.0077
Further Details:      
 
Domain Number 2 Region: 393-526
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000043
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 3 Region: 298-355
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000628
Family Second domain of FERM 0.0069
Further Details:      
 
Weak hits

Sequence:  FBpp0113290
Domain Number - Region: 550-600
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000131
Family Second domain of FERM 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0113290   Gene: FBgn0087139   Transcript: FBtr0114798
Sequence length 711
Comment type=protein; loc=scaffold_13337:7144564..7146699; ID=FBpp0113290; name=Dana\GF10098-PA; parent=FBgn0087139,FBtr0114798; dbxref=FlyBase:FBpp0113290,FlyBase_Annotation_IDs:GF10098-PA; MD5=304616edaf74f505085d50787e792431; length=711; release=r1.3; species=Dana;
Sequence
MIHVGENTWNLRILITDLQVEKTLRVKGDQHIGGVMLQLVDPEMPKDWSDHALWWPAKNV
WLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQLPDLRYLDYRVNFSAKTFGAVVSLCKDL
DIRYPEELSLCKPVEPEHLKKNFSKLPQRKIPVAEANGVSYLQPAPDTNSFVPIAGAYNG
SNGSLDRSHNGNLLYAPASPYATTPRRAATAPGTPISSPTGTWKHSSTGYTSYDSNSSFG
DFQENLAVSPRSPSPDVRSRLVRPKTLVEKARLNVGWLDSSLSIMEQGVREFDTLCLRFK
YFTFFDLNPKYDQVRINQLYEQAKWSILNEELDATEEETLMFAALQFQVNHQTDLHPPGI
DSGIDSSSQENGGDDDIDSALNELQITLEGPGGGKDQGNITRIPELSDYLRFLKPQRFTL
KGYKRYFFAYRDLHLHLYKSQEESRRGAPTISINLRGCEVTPDVTLAQGKFAIRLEVPPE
GRNGPNSEVWVRCENEEQYAKWMAACRLAAKGRSLADSSYDSEVNSIRSLLQMQKPAQGA
PLTINPRSVDPMDYLSQKMLRKLSSKAVQRILEAHANVRQLPLMEAKLKYIQAWQSLPDF
GVSLFVIKFDGHKKEELLGVAHNRIMRMDLSSGDHIKTWRYNTMKAWNVNWGIKCMMIQF
ADENVVFSCLSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTGGWS
Download sequence
Identical sequences B3M5G9
FBpp0113290 XP_001956773.1.52611 7217.FBpp0113290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]