SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0115702 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0115702
Domain Number 1 Region: 36-136
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-24
Family PDI-like 0.043
Further Details:      
 
Weak hits

Sequence:  FBpp0115702
Domain Number - Region: 227-287
Classification Level Classification E-value
Superfamily ARM repeat 0.00978
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0115702   Gene: FBgn0089547   Transcript: FBtr0117210
Sequence length 322
Comment type=protein; loc=scaffold_13266:join(412508..412680,412878..413039,413100..413274,413471..413929); ID=FBpp0115702; name=Dana\GF12510-PA; parent=FBgn0089547,FBtr0117210; dbxref=FlyBase:FBpp0115702,FlyBase_Annotation_IDs:GF12510-PA; MD5=680a02ff33e8667d287749124828f830; length=322; release=r1.3; species=Dana;
Sequence
MQRKSHLVAVSCVIAVLLAQAALAQSPTHSGLQPGGKLIELDEDNWHRMLQGEWMIEFFA
PWCPACKNLAPTWERFARVAKDVQVQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQ
YRGARDGDALLFFVKKKQWESIEPLSAWKKPDTIHMSVLSYFFKLSHTLKDFNGRLQEEY
GLPTWGSYALFAIATIFVGAALGLMLVCLVDFVYPPKKSQRQSFSESQEHLADGVEDLAT
EEIEDDAEAEQNEDSDEEEQDDDDEEDNEEEDSEEQPGDAPSQEKDADSEPEKVEEPEPK
QVGDAAPEKTEPVRKRKPRKGD
Download sequence
Identical sequences B3ME88
7217.FBpp0115702 XP_001958661.1.52611 FBpp0115702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]