SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0115799 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0115799
Domain Number 1 Region: 451-760
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-77
Family Protein kinases, catalytic subunit 0.0000000388
Further Details:      
 
Domain Number 2 Region: 1186-1322
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 7.72e-51
Family FAT domain of focal adhesion kinase 0.000038
Further Details:      
 
Domain Number 3 Region: 146-265
Classification Level Classification E-value
Superfamily Second domain of FERM 2.27e-33
Family Second domain of FERM 0.00018
Further Details:      
 
Domain Number 4 Region: 268-398
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-24
Family Third domain of FERM 0.0012
Further Details:      
 
Domain Number 5 Region: 20-96,128-144
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000775
Family First domain of FERM 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0115799   Gene: FBgn0089643   Transcript: FBtr0117307
Sequence length 1431
Comment type=protein; loc=scaffold_13266:join(1940681..1940726,1940811..1941531,1941597..1941706,1941779..1942017,1942076..1942577,1942634..1942766,1942823..1942955,1943016..1943079,1943144..1943224,1943302..1943506,1943565..1943704,1943763..1943911,1944125..1944814,1944991..1945080,1945138..1945592,1945655..1945765,1945824..1946250); ID=FBpp0115799; name=Dana\GF12607-PA; parent=FBgn0089643,FBtr0117307; dbxref=FlyBase:FBpp0115799,FlyBase_Annotation_IDs:GF12607-PA; MD5=d7f3356d340d1d9dedc57742f3252d69; length=1431; release=r1.3; species=Dana;
Sequence
MNVVESSQPPPTSHDSLLDEYVIHVHMPNKSFKAVKFSVKETVFNVIRKTIEDLGRDGRP
PSIQRYACRMMNMITKEVIWLARTTPMQKVLTHILTPGCANVDCPNNEDAKFEFEEGMLH
HQDQGKRVIANRVWRVELRVRYVPNSIQDLFDEDKATCFYYFNQVKEDFIQANVTAIDTD
VAVQLCCLGIRHFFKNITVKAPDKKQHIDYIEKEMGFKSFLPQSVIATTKPKNLKKLIQV
GYKKVYNYNDIEYLTRFFDLLKNIYLTNFEQFSVTLSSAWNISGILHVGPHIGISYQTHP
QASLKNVAQFKDVVAIKTCTLPKEKLPKASENATESTESHNFNCNCQKIKTQIKISASNN
VEDLVITCNGINTAESIADLIDGYCRLLSKDLEFTIWQRETTASTSDDSTKASSNNATLE
SNKSGASPAKPMLTDDYAEIGLMEGEGDYSTPTVRNYELDRAHITPSAKIGVGQFGDVYV
GTYTLPKSAKAKNFVGNGKDSSNSDQRNADGRPDVIQVAIKTCKANDDPEKTENFLAEAY
IMQKFDHPHIIRLIGICSVMPIWIVMELAKLGELRAYLKTNSERLSHGTLLKYCYQLSTA
LSYLESKKFVHRDIAARNVLVSTPTCVKLADFGLSRWVSDQSYYHSTPTVALPIKWMSPE
SINFRRFTTASDVWMFGVCIWEILMLGVKPFQGVKNSDVISKLENGERLPLPPNCPPRLY
SLMSQCWAYEPLKRPNFKRIKETLQEILIEDSISSSETLKREHRRVATMSWVGSDDVDIP
PMKPSRAIHDSDLSNLMSNVNETTSTPQTYIIAQNPAVLAKLMMENQKRGINPAAYTTPA
SAGMFTGSLPSKSSFVVCAPHTEDQMPMENNMSNPAVSKVAGYSLYGSLERHQPAPAKSM
HSKGGSLERHQSLMSAQNLVFYNAKPPPHCTNTAERSRSMERNTYFHAYRQQMKTSIECE
ALPEEIYDFGGAGLKTCVSNKQQPQCSPMMNLCPVEIPQVPVPECSGMHPNIPPSGQTSS
FGVISPHNLESQREWERQWMLSGQQNVGMGPSASDGAVCMATLQAEAMGNQAIHNVMGEK
LRQQRKDSNSDSEWLIQEELLRRRSSSIPHGALLDHQQQMLRLDLMSAGPSSLPDCSNSS
SRPMTPNANLLSLKSNNSSADHLSGSHTGEDQTGSNARNFGHSVSSRPLNRADDEVYCAT
TMVVKSIMVLSQGVEKANTEGYLELVKNVGVKLRNLLTSVDRISVLFPAQALKEVQMAHQ
VLSKDMHELVSAMRLAQQYSDTTLDCEYRRSMLSAAHALALDAKNLFDVVDSIRQRYDNL
FPASNPKDHVSSSNFEPSSSHEPINELGAHLKSSTSGDLLHGTGIYDNDLHQSFSSQLQL
QGVANNSGGSGSLQRGMSLDPTNEPLRIVEENLGSPGEHMYCNTSALHGHA
Download sequence
Identical sequences FBpp0115799 7217.FBpp0115799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]