SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0115943 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0115943
Domain Number 1 Region: 25-136
Classification Level Classification E-value
Superfamily Lysozyme-like 6.82e-39
Family C-type lysozyme 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0115943   Gene: FBgn0089785   Transcript: FBtr0117451
Sequence length 164
Comment type=protein; loc=scaffold_13266:join(4040945..4041092,4041150..4041302,4043385..4043578); ID=FBpp0115943; name=Dana\GF12751-PA; parent=FBgn0089785,FBtr0117451; dbxref=FlyBase:FBpp0115943,FlyBase_Annotation_IDs:GF12751-PA; MD5=387965b6f2eae7d4e1362d8d8dcf6529; length=164; release=r1.3; species=Dana;
Sequence
MKALWLWLIPVSVLFLLGLEQVESKKYQRCELTRVLVENYNFDKTFLSNWICLVEHESEL
NTSKITPKENNSKNYGLFQINSKNYCSEGRKGGQCNKKCEDFSNDDIGDDIVCAKMIQER
EGFKYWKGWDRFCRNPQNLPNLRVACNLRSLSPLRTPRGFLGHG
Download sequence
Identical sequences B3MIT6
7217.FBpp0115943 FBpp0115943 XP_001959174.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]