SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0118187 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0118187
Domain Number 1 Region: 37-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.36e-277
Family Motor proteins 0.000000000173
Further Details:      
 
Domain Number 2 Region: 1947-2063
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-24
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 3 Region: 1244-1347
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-21
Family First domain of FERM 0.029
Further Details:      
 
Domain Number 4 Region: 2064-2154
Classification Level Classification E-value
Superfamily PH domain-like 8.96e-21
Family Third domain of FERM 0.018
Further Details:      
 
Domain Number 5 Region: 1847-1955
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-16
Family Ras-binding domain, RBD 0.084
Further Details:      
 
Domain Number 6 Region: 1339-1435
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000393
Family Second domain of FERM 0.0085
Further Details:      
 
Domain Number 7 Region: 1561-1631
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000111
Family SH3-domain 0.0035
Further Details:      
 
Domain Number 8 Region: 787-855
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000022
Family Motor proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0118187   Gene: FBgn0092020   Transcript: FBtr0119695
Sequence length 2167
Comment type=protein; loc=scaffold_12916:join(808154..808171,808745..809005,809173..809522,809583..809783,809837..812231,812294..813744,813809..814595,814653..814913,814977..815281,815343..815489,815551..815671,815816..816022); ID=FBpp0118187; name=Dana\GF14995-PA; parent=FBgn0092020,FBtr0119695; dbxref=FlyBase:FBpp0118187,FlyBase_Annotation_IDs:GF14995-PA; MD5=d27409dbfc90e7b9e907278882945b2d; length=2167; release=r1.3; species=Dana;
Sequence
MVIVTRGDYIWIEPASGREFDVAIGARVISAEGRRIQVRDDDGDEVWLAPERRIKAMHAS
SVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTADQIKLY
KERKIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKH
SWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRI
VSQNHSERNYHVFYCILAGLSPEEKGRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIR
SAMKVLLFSDQEIWEIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLP
IGPLIDALTRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRLFVHIVRKINTAIFKPR
STSRNAIGVLDIFGFENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQH
IEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDQTMLAKLHKTHGAHKNYLKPKSDIN
TSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSGNKFLRQIFAQDIEMGAETRKR
TPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIR
IRRAGYPIRHGFREFVERYRFLIPGVPPAHRTDCQAATSRICAVVLGKSDYQLGHTKVFL
KDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYR
NMRVGYMRLQALIRSRVLSHRFRHLRGHIVGLQAHARGYLVRREYGHKMWAVIKIQSHVR
RMIAVRRYRKLRLEHKQFAEVLQLRKLEEQELLHRGNKHAREIAEQHYRDRLHELERREL
QEQLEDRRRVEVKKNIINDAARKQEEPVDDSKLVEAMFDFLPDSSSDAPTPHGGRETSVF
NDLPHAQNVNQEDIIAPIHISEDEEDLSEFKFQKFAATYFQGNVNHQYAKKALKHPLLPL
HTQGDQLAAQALWITILRFTGDMPEPKYHTMDRMDTTSVMSKVTATLGRNFIRSKEFQEA
QLMGLDPDAFLKQKPRSIRHKLVSLTLKRKNKLGEDVRRRLQDDEYTADSYQSWLQSRPT
SNLEKLHFIIGHGILRAELRDEIYCQICKQLTNNPLKSSHARGWILLSLCVGCFAPSEKF
VNYLRAFIREGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGN
TKTLLADSATTARELCNQLSDKISLKDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQ
YAKEQGAQERNAPWRLFFRKEIFAPWHEPTHDQVATNLIYQQVVRGVKFGEYRCDKEEDL
AMIAAQQYFIEYGTDMSMERLFTLLPNFIPDFCLSGVDKAIERWAALVLQAYKKSYYVKD
KIAPLKIKEDIVSYAKYKWPLLFSRFYEAYRNSGPNLPKNDVIIAVNWTGVYVVDDQEQV
LLELSFPEITAVSSQKTNKVFTQTFSLSTVRGEEFTFQSPNAEDIRDLVVYFLDGLKKRS
KFVIALQDYRAPSDGTSFLSFFKGDLIILEDESCGESVLNNGWCIGRCDRSQERGDFPAE
TVYVLPTLSKPPQDILALFNIEEAHHGRRLSMASNGGAVEPRDRPHTLMEYALDHFRLPP
KRTMSKTLTLSSKRSEELWRYARDPIKAPLLRKLQSKEELAEEACFAFAAILKYMGDLPS
KRPRMGNEITDHIFDGPLKHEILRDEIYCQLMKQLTDNRNRMSEERGWELMWLATGLFAC
SQGLLKELLLFLRSRRHPISQDSMHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVY
FPDDTDEAFEVDSSTRAKDFCNNISQRLSLRTSEGFSLFVKIADKVISVPEGDFFFDFVR
HLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYH
KCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIMKMQSTSEWKRSIVASYNQ
DGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKD
ILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTNMNK
NRTLRAN
Download sequence
Identical sequences B3MLC3
7217.FBpp0118187 XP_001961491.1.52611 FBpp0118187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]