SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0119060 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0119060
Domain Number 1 Region: 39-790
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-272
Family Motor proteins 0.000000000212
Further Details:      
 
Domain Number 2 Region: 2027-2116
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-19
Family Third domain of FERM 0.012
Further Details:      
 
Domain Number 3 Region: 1818-1922
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000031
Family First domain of FERM 0.038
Further Details:      
 
Domain Number 4 Region: 1914-2026
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000055
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 5 Region: 1325-1421
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000222
Family Second domain of FERM 0.014
Further Details:      
 
Domain Number 6 Region: 1242-1332
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000327
Family First domain of FERM 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0119060   Gene: FBgn0092891   Transcript: FBtr0120568
Sequence length 2121
Comment type=protein; loc=scaffold_12916:join(15627158..15627181,15628861..15629124,15629185..15630306,15630369..15630884,15630974..15632002,15634207..15634416,15634479..15634768,15634824..15636359,15636416..15636539,15636598..15637848); ID=FBpp0119060; name=Dana\GF15868-PA; parent=FBgn0092891,FBtr0120568; dbxref=FlyBase:FBpp0119060,FlyBase_Annotation_IDs:GF15868-PA; MD5=676de23e4d6aade5dfe122afaf96ba89; length=2121; release=r1.3; species=Dana;
Sequence
MSEFVRQHGEYVWVKPQNTTSEFAVPFGARIVRTEKTQTLVCDDRNKQFWVPAGDVLKAM
HITSQEDVEDMITLGELQEYTILRNLQNRYAKQLIYTFTGSMLVAINPYQILPIYTNREI
QLYRNKTLAELPPHIFAISDNAFQRLQRLKENQCVVISGESGAGKTESTKLILQYLAAIS
GKHSWIEQQIIEANPIMEAFGNAKTVRNDNSSRFGKYIEIRFTPEGAIQGARIQQYLLEK
SRIVFQSREERNYHIFYCMLAGLSAPERERLKLQEQSPSQYHYLAQGGCFTLPGRGDAKD
FADIRAAMKVLSFKPEEVWSIFSLLAAILHLGNLRFKATEIANLEAAEIDDPQNLQRVAQ
LLGTPISSLNAALTQRTIFVHGEHVTTSLSKEGALEGRDAFVKALYDGIFVRIVRRINET
IDKQVDRPMNSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVGHIFKMEQDEYQNEH
INWQHIEFQDNQQILDLIGMKPMNLMSLIDEESKFPKGTDQTLLEKLHVQHGNRSIYVKG
KTTQTSLFGIRHYAGVVMYNPLGFLEKNRDSFSGDLRSLVQRSANKYLVDIFPHEIPMDT
AKKQPTLCVKFRNSLDMLMRTLSQAHPYFIRCIKPNEYKEPKNFDKELCVRQLRYSGMME
TARIRRAGYPIRHAYRAFVERYRLLIPPVGPLEKCDCREVTRQICDVALPANSDRQFGKT
KLFLRDEDDASLELQRSQVMLKSIVTIQRMIRRILFRRYMKKYREAIITVQRHWRGRLQR
RKYQVMRQGFHRLGACVAAQQLTTKFTMVRCRTIKLQALIRGYLVRKDFKNRLQERRKQQ
QLKKEELLRLAKIKEAEEVQRLKLLKEQKAKEQKELEEKRLKEEQRLKAEAAARNALAMA
AVQQPKRTSRSFKQEAPKAPTLQARMSLPPPPPTSYIAAAPLPIRPASSATSRINTIPES
PGTIDVESSKQMVDDVFRFLNDEPDAALRKLNSITTGNTIRLPKQIPNNIDTSDFSYLKY
ASTYFCGGATAQHERKPLKQSLLQHEQPVDEMASKAIWLTILRFMGDLPDINQTPSILSL
DNANLMSDLTRLLSVSGSVKPRLFVRQRPLKLMDGGQREVEEFYQHWITVSSSHLDKINF
IVGHGILKESLRDEILAQICKQLYLNPSRNSYTRGWLLLTLCLSCFPPSSKFEPHLRSFM
KQGTAQLQAAPALQRLERTLVNGVRSQPPSLFELQAIRERLPLKLDIHLMDGQQRRLQVD
AASTAREAVNQLCKGLGLVNTFGFGLVMSLHGKLFPMGAGQEHILDAVSECEQRQLDSPW
KIYMRKEMFATWYDPTVDSKATHLIYKQIVNGLKLGEYRCRSENDIAMVCALACFIEHGP
GDIRRLKSSEITAFVPSDLLAPGEKAISNWSRLITATYEKSSYVRQEQKDLLEEAQQRAK
EDICLFAHLTWPMRHSRLFEVVRREGPKLQSDDLMLGINATGLFLIDETEQVLASCSFAE
LLKVYNEVNDEIHVLTFQQVNFVLQCSTAQDASEMINYMLENLQERSSYGIALDNSQDTD
QEDFLVLAPGDLIEFEAGVTGSKILSSNAQDVYRGCANGQWGNFAAGNVRVLATLTKPSA
KLQEIFKEGHLDAPPKPMPRSVHIRRRQHNISQLAETQFREPIETDMAPLTKYSPEPLKA
PLLKAVVKVAPLFQQALVIHHHILKYMGDIARSNLPVNTDLIFQPALQHPLLCDELYCQL
MKQLSDNPSAESEKRGWDLLYLATGLVAPSVLVMRELIILLRMRADGLADACLKRLKRSL
AQGQRKQAPHLIEVEGIQQRCLHIYHKVYFPDDTVEAFEIESHTRGAELIADIAQRLELK
SPVGYSIFLKTGDKVYAMPEEEFVFDFITQLIFYLRQQKTLRSMSDGHYQLHFMRKLWLN
NLPGEDLNGDIIFSYPQELHKYLKGYYPIDCEQASHLAGLLYSADHEVSLQRLPEVLPRL
VPEDLIPLLTVAEWRHQILPRLHHDNITEDQAKILFLQELSRFSCFGSTFFVVKQQNDDT
IPETILIAINSSGFHLLDLQTKEVLRSYEYSQLGIWSSGKNHFHIRFGNMIGASKLLCNT
SQGYKMDDLLASYSRYFNQAE
Download sequence
Identical sequences B3MKC8
FBpp0119060 7217.FBpp0119060 XP_001963291.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]