SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0120355 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0120355
Domain Number 1 Region: 289-416
Classification Level Classification E-value
Superfamily Second domain of FERM 8.77e-28
Family Second domain of FERM 0.00095
Further Details:      
 
Domain Number 2 Region: 49-142
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-17
Family PDZ domain 0.0095
Further Details:      
 
Domain Number 3 Region: 14-52
Classification Level Classification E-value
Superfamily WW domain 0.000000000341
Family WW domain 0.0024
Further Details:      
 
Domain Number 4 Region: 199-247
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000093
Family Ras-binding domain, RBD 0.063
Further Details:      
 
Weak hits

Sequence:  FBpp0120355
Domain Number - Region: 431-513
Classification Level Classification E-value
Superfamily PH domain-like 0.0344
Family Third domain of FERM 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0120355   Gene: FBgn0094181   Transcript: FBtr0121863
Sequence length 1366
Comment type=protein; loc=scaffold_13340:complement(5998339..6000908,6000969..6001146,6001207..6001356,6001420..6001564,6001624..6001883,6002200..6002448,6002507..6002942,6002999..6003111); ID=FBpp0120355; name=Dana\GF17163-PA; parent=FBgn0094181,FBtr0121863; dbxref=FlyBase:FBpp0120355,FlyBase_Annotation_IDs:GF17163-PA; MD5=4b4fdb1549010b388a1f95a21488ffe1; length=1366; release=r1.3; species=Dana;
Sequence
MTQSSGWLPACEDWSKHEELSYGWERAIDSKGRSYYINHLNKTTTYEAPECIRWDEHPPE
PRHVQLQRNASLGFGFVAGSERPVIVRFVTEGGPSIGKLQPGDQILAVNGEDVKDAPRDH
VIQLVRACEAQVNLLVCQPMAHCVLPGRKSTLLSAGKRAKLRSRPSRVRFAESVCVNGAP
LFPTSAFSLGDICVPPMANVLKVFLENGQTKSFKYDATTTVQDVVSSLLDKLCLCCGELF
SLVLEHVKSLKRNKLTLLDPQESLARIAARPGAHKLRCLFRITFVPISAAELAQRDLHAL
DYLYMQCCNDVNQERFAPELQPELALRLAALHMHQHALANNFAPAKLTVKLVEREFGLER
FVPVTLFEGMKRKELRRLISHFLKLNAEMTGSSSKVLTQLQAKLHYLDIIASLPSYGAKC
FSTNQREGMERVLLVSPRFGLSQISSARNSVPQPISAIEDFTHVVVNREDDVTCSVSIFM
LGDRAVKFTMEDRDACEFSLVLGGYYRLLTGNMLNVLREREPQDEDNAPGFLAQHTVLPA
GWSYLLPFHTRAHSVSFLMTPPYHPIAQKGQLQHQSSIQAPASLPYATDLDLHSVMATEL
LEEAAKDSGLSDSSGSNYCEGRSHLGSQQLEAKNEQVLRRVQELQHLVQTSEQYLSEQEQ
GGGGGGVAMLEFDSDCDSLKSSKVSSTEESQGGLVLGSSVGISPGHPGMKHSDSLTLLAE
TINHELSGITQGLNAIPETAPVSSSAPATPATPKRKPSLCTTSSPRPQRKLNGFSQLLSD
LQALGTDFSQSESDSESVASPAQSPTARRPQMMLLQAAGSGPGAAAKQQLSQRSSFGLHS
PDGTHFGAETKDYNLREYLQQLKEISNAASADTDVAARQLSEIYGFEVREDTFIETDTDL
IDLRSIPPPQTPDELDSLSLMNAAPPKGFEGKAEELDSFLQQIMVAPPTQKATPAKELTP
EEIMSFIIPPPPNLEQQQQVVQPVAQPEETECLYSNSVQAKREFFQSVANGNSSSSTPHV
IEYATVERKSKFSCCPTSKKEEADQEELQPPPRTPTSEQLSPPPARPPKSAELLQRYSPK
KQVRIATSPVLQPERRELCPPQLPPRGSPTLDGNQSPNPNASLVSGPKKPPLPPIASRPR
PQNGVNPAPSTAQTAPPAHYSPPIPATVRLPQFNNHQTNGTLPMLPKKPQQLHGEKLFIK
NGHLIDGEALLAKTDVAMAGLLIKLDQVAAQCSAAQAAGGGTSIDEEKFQRARNELTEQT
LALVTASKFLVASMSDMTLITLPEHLTSCLTAIRRITELAQDMTRHTSAPLQTRNIVLKV
HDVASSFRELVGVEIGPVGAGQLALHAECLANVLATLLRSLRVFSP
Download sequence
Identical sequences 7217.FBpp0120355 FBpp0120355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]