SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0120571 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0120571
Domain Number 1 Region: 242-386
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-40
Family Third domain of FERM 0.0006
Further Details:      
 
Domain Number 2 Region: 140-244
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-33
Family Second domain of FERM 0.0000935
Further Details:      
 
Domain Number 3 Region: 58-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-23
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0120571   Gene: FBgn0094397   Transcript: FBtr0122079
Sequence length 988
Comment type=protein; loc=scaffold_13340:complement(1813994..1814170,1814566..1815165,1815335..1815492,1815551..1815705,1815767..1815886,1816021..1816155,1816223..1817297,1817354..1817530,1817599..1817746,1818275..1818496); ID=FBpp0120571; name=Dana\GF17379-PA; parent=FBgn0094397,FBtr0122079; dbxref=FlyBase:FBpp0120571,FlyBase_Annotation_IDs:GF17379-PA; MD5=038db33a0028cd892af1b4ce80d0d182; length=988; release=r1.3; species=Dana;
Sequence
MLRFLSRRKVRNNYADNVRGGGGGGGAPMGGGVGGAGALASGSQIKPQRIVVNKNKIDCR
VILLDNTDLSIELSKKALGSFLYEQVFYALDIIEKDYFGLQFTDANHVKHWLDPTKPIKK
QVKIGPPYTFRLKVKFYSSEPNTLREELTRYLFFLQLKQDLLEGRLDCPDDKSTELCALA
LQSELGDYDDQVHSAATVSEFRFVPEQTEDLEISILEEYKTCRGLTPAQAETAFLNKAKW
LDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIVI
EDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLRAPVKGPSARQNFFRMGSRFR
YSGRTEFQTTQQSRARRTVQFERRPSQRFASRQSHLLRERQKASQESAASAVASVNARAA
AAAAAAAASSQAAAIVPPVASSKISSPLPSNENNNDAFDSLISTDQFITVTPSPSVLTVI
QNSAIIEPDAACSGSISSSSQAAAATCASLGRNSLKSNFSNEDPAYSKIGSIGKAAGLTV
RLDSEYTPPYSPNSTKNFDETNPFRNATASHHGSFGKASISSGQLSVKSGLSDKDRELDS
LLKSIVKDPSPSVLANEAINDANSIRVTINKTFDMDHNTETLKRLSNANEKPNNQVKLAN
VSTTALPPGNIKCNILKARVEEELGAGGNAKLTNQMFVPAAHPSTVHSSNSNMNSGSDGP
DSLNATYISVGGDKLTLSIPEQKPSTGSSSTAASSSSSTSSTTNGNPNSSFSNATFVSGF
NAPLTPPSSLPVNLNNTGGVSTSVTTISTPSSPTASVSTAATESLVPTLSNASAAEILIN
EIFINNIINNNANANSSTSTTSGNTNDSAPKPAGSSTPSAGTLLFSTLSEQERLETQKTN
EQLRKQNQSLNQNPNQNQNHSEVDAPPSEKKNPSNYPDNSRTTFPSNSNGNSNSNEMVSP
WLVSSEVVSAPKGREPTIIRKSVITTQL
Download sequence
Identical sequences B3LX90
FBpp0120571 XP_001953107.1.52611 XP_014766405.1.52611 7217.FBpp0120571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]