SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0121084 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0121084
Domain Number 1 Region: 539-668
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-18
Family Second domain of FERM 0.0016
Further Details:      
 
Weak hits

Sequence:  FBpp0121084
Domain Number - Region: 134-212
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.046
Family Arfaptin, Rac-binding fragment 0.084
Further Details:      
 
Domain Number - Region: 296-350
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 0.0615
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0121084   Gene: FBgn0094910   Transcript: FBtr0122592
Sequence length 838
Comment type=protein; loc=scaffold_13340:join(6821269..6821636,6821700..6822472,6822566..6822732,6822788..6823134,6823196..6823357,6823414..6823602,6824952..6825081,6825137..6825235,6825298..6825448,6825508..6825638); ID=FBpp0121084; name=Dana\GF17892-PA; parent=FBgn0094910,FBtr0122592; dbxref=FlyBase:FBpp0121084,FlyBase_Annotation_IDs:GF17892-PA; MD5=06e6a836cae675a2318cd76dff7ef031; length=838; release=r1.3; species=Dana;
Sequence
MEPNHYYCRGAMQQTSAASSIPQHSSNKVNYGMNAGQEYVTCSSGQQQSGYNSKDLVPRN
GNNKSLSGNGNGMGSPYGGSICSNSGQCNKNTTANAGNYINIMTVPLGTLQYNRKKLSTQ
DYESHLYYNTTDVKCRDNYYLANANAAAAIPQLQAHQPQQQQLQQQQQQQQSHQQHQQHQ
QHQHHQQHQQHHHHQHQQHQQSQQLQQQQHANFLHIQQSLQHNHQLGHPESIHQLPQLAS
SVPDPPDAFDNCAMFPSAGGTGRVAATQTHQNSSMIACEQQTPVSLASVNVPVPPIMYTV
HRVVTTAQIQTAVGSTFASSASVSSVVSTGQNEGDCLSPAQVSSAMAASTNAPCLVGDMG
GNMINNANALCPLSDLRSPSGVIGNSSFMSAHHKCSTSNDSQSNPAIQKRVMATSSTSNF
TNTGKAASNLSRALQNVIPTCVYLMSRVAVHMEIEGTAQCPSQVMLAAALGCEELGISNK
LLAQSVFGLWMTSALLEMQLKAHHCPYIVRVAWPNLLQKFSNSSPSDRKFDEPMIVLKRN
VFFSKRDEEKIKDHRILELLYEEARNNVLTGRYIMEPVHSLMLGGIQARIELGPYNSHSH
TIGFFRENQARFLPPHVAKSSTWLWLPISQKNSAEVKLLEQFKRVPQTATTRKLMRKYLE
FCWALPFYGAAYFHGQIEQPVRGIMALVNQKDMEVLIAVNERGVFIIDPYECTLLLGLRY
EDLSWDYAKPSASDDPECLTCIFLQFDVVENGIQVSKLMQIFSKQAAMIDALISHFTDQI
RNKKQEGNTAEPFHDEPNPIQNNGNGVLCNKLSRLTLATFDEEGGRCIGQMGSLSISY
Download sequence
Identical sequences B3M271
7217.FBpp0121084 FBpp0121084 XP_001953701.1.52611 XP_014766667.1.52611 XP_014766668.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]