SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0122316 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0122316
Domain Number 1 Region: 271-413
Classification Level Classification E-value
Superfamily PH domain-like 4e-41
Family Third domain of FERM 0.000000573
Further Details:      
 
Domain Number 2 Region: 161-270
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-37
Family Second domain of FERM 0.00000355
Further Details:      
 
Domain Number 3 Region: 561-646
Classification Level Classification E-value
Superfamily Moesin tail domain 2.09e-27
Family Moesin tail domain 0.000058
Further Details:      
 
Domain Number 4 Region: 21-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-16
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0122316   Gene: FBgn0096135   Transcript: FBtr0123824
Sequence length 646
Comment type=protein; loc=scaffold_13047:complement(616824..616988,617056..617268,617346..617733,617797..618563,618702..618728,618943..619074,619225..619404,620799..620867); ID=FBpp0122316; name=Dana\GF19124-PA; parent=FBgn0096135,FBtr0123824; dbxref=FlyBase:FBpp0122316,FlyBase_Annotation_IDs:GF19124-PA; MD5=899fee54b1c249e3ae976bec28f104ab; length=646; release=r1.3; species=Dana;
Sequence
MVVVSDSRVRLPRYGGVSVKRKTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLRE
VWFFGLQYTDSKGDSTWIKLYKKPESPAIKTIKYLKRVKKYVDKRTADSNGMSQAETSEE
DDDADDMTGSMPFSTWVMNQDVKKENPLQFRFRAKFYPEDVAEELIQDITLRLFYLQVKN
AILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVIDQHKMSKDEW
EQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIY
EQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRINKRILALCMGNH
ELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLKQMQ
EEMERSQRDLLEAQEMIRRLEEQLKQLQAAKDELELRQKELQSMLQRLEEAKNMEAVEKA
KLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEEARRKQAEAAAALLAASTTPQHHHV
AEDENENEEELTNGDAGGDVSRDLDTDEHIKDPIEDRRTLAERNERLHDQLKALKQDLAQ
SRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM
Download sequence
Identical sequences B3MZH6
XP_001966732.1.52611 7217.FBpp0122316 FBpp0122316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]