SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0123461 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0123461
Domain Number 1 Region: 209-354
Classification Level Classification E-value
Superfamily PH domain-like 6.5e-42
Family Third domain of FERM 0.00000756
Further Details:      
 
Domain Number 2 Region: 101-208
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-31
Family Second domain of FERM 0.0000085
Further Details:      
 
Domain Number 3 Region: 546-635
Classification Level Classification E-value
Superfamily Moesin tail domain 3.14e-24
Family Moesin tail domain 0.0017
Further Details:      
 
Domain Number 4 Region: 9-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-23
Family First domain of FERM 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0123461   Gene: FBgn0097276   Transcript: FBtr0124969
Sequence length 635
Comment type=protein; loc=scaffold_13417:complement(1237266..1238069,1238122..1238358,1238416..1238625,1238687..1238789,1238851..1239404); ID=FBpp0123461; name=Dana\GF20269-PA; parent=FBgn0097276,FBtr0124969; dbxref=FlyBase:FBpp0123461,FlyBase_Annotation_IDs:GF20269-PA; MD5=7f7ad576c0ce7999eb7ea34844a3794e; length=635; release=r1.3; species=Dana;
Sequence
MSPFGSKKNRSLSVRVSTFDSELEFKLEPRASGQDLFDLVCRTIGLRESWYFGLQYVDTR
SNVSWLKMDKRVRDQRVDLQANNNTYVFSFYAKFFPENVSEELIQEITQHLFFLQVKQSI
LSMDIYCRPEASVLLASYAVHVQYGPYDYETYKDGMLAGGELLPKGVTDQYQMTPEMWEE
RIKTWYMDHEPMTRDEVEMEYLKIAQDLDMYGVNYFPITNKNKTKLWLGVTAVGLNIYDE
RDKLTPKTTFQWNEIRHVSFDDKKFTIRLVDAKVSNFIFHSQDLHINKMILDLCEGNHDL
YMRRRKSDTMEIQQMKAQAKEEKQRRHIERKKFIREKKLREKAEHERYELEKSLEHLQNE
MRMANDALRRSEETKELYFEKSRVNEEQMQLTECKANHFKTEMDRLRERQMKIEREKHDL
EKKIRDADFYVHQLTVENDKREAETEKLRKELICAKMAEREATALLLNFLNSGRKSSTDS
LLAAANVHVTQSNNAASSLAAVSTPSLATSSSTNDIDTAGGAELTTHYLAQGDNSSGISD
DFEPKEFILTDNEMEQITNEMERNHLEYLRKSKKQVQNQLQTLRSEIAPHKIEENQSNLD
ILSEAQLKAGENKYSTLKKLKSGCTKARVAFFEEL
Download sequence
Identical sequences B3MQC8
XP_001963478.1.52611 7217.FBpp0123461 FBpp0123461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]