SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0127526 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0127526
Domain Number 1 Region: 507-669
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.09e-64
Family A middle domain of Talin 1 0.0000368
Further Details:      
 
Domain Number 2 Region: 2299-2491
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.01e-51
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 3 Region: 678-800
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.41e-51
Family I/LWEQ domain 0.0000729
Further Details:      
 
Domain Number 4 Region: 770-906
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.87e-44
Family I/LWEQ domain 0.00017
Further Details:      
 
Domain Number 5 Region: 1851-1982
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.1e-32
Family VBS domain 0.00033
Further Details:      
 
Domain Number 6 Region: 1235-1371
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.1e-32
Family VBS domain 0.04
Further Details:      
 
Domain Number 7 Region: 203-317
Classification Level Classification E-value
Superfamily Second domain of FERM 1.15e-28
Family Second domain of FERM 0.0000088
Further Details:      
 
Domain Number 8 Region: 318-408
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-25
Family Third domain of FERM 0.0000536
Further Details:      
 
Domain Number 9 Region: 1092-1218
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000146
Family alpha-catenin/vinculin 0.052
Further Details:      
 
Domain Number 10 Region: 2017-2141
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000091
Family VBS domain 0.01
Further Details:      
 
Domain Number 11 Region: 962-1062
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000981
Family I/LWEQ domain 0.0053
Further Details:      
 
Weak hits

Sequence:  FBpp0127526
Domain Number - Region: 1478-1565
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000334
Family I/LWEQ domain 0.0077
Further Details:      
 
Domain Number - Region: 1592-1665
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00118
Family VBS domain 0.092
Further Details:      
 
Domain Number - Region: 83-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00173
Family Ubiquitin-related 0.056
Further Details:      
 
Domain Number - Region: 1711-1806
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00267
Family alpha-catenin/vinculin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0127526   Gene: FBgn0101328   Transcript: FBtr0129034
Sequence length 2847
Comment type=protein; loc=scaffold_13337:complement(8072874..8073138,8073208..8073797,8074042..8074713,8075110..8075625,8075687..8075803,8077869..8078059,8078124..8082711,8082796..8082912,8083276..8083364,8083681..8083769,8083829..8084332,8084388..8084466,8084527..8084718,8084779..8085177,8085242..8085377); ID=FBpp0127526; name=Dana\GF24334-PA; parent=FBgn0101328,FBtr0129034; dbxref=FlyBase:FBpp0127526,FlyBase_Annotation_IDs:GF24334-PA; MD5=fa474b984af034b1383327f83ba44017; length=2847; release=r1.3; species=Dana;
Sequence
MSTLSLRIQLEGGRVTKTIQFQPNTTVFDACKIIRDKFAEAVQGQPSEYGLFISDEQNQQ
GVWLEAGRTLGYYILHNQDTLEYRRKLRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDNDAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMN
WVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQ
EKACEFAGIQVHIQFGPHNESKHKPGFLDLKDFLPTSYVRVKGIEKKVFLEHRRHSELSE
IDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDERTKEILVSW
PLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGI
EGDEGSTMVEESVAPSKATFLQHETNRGEQLNVESLAHPGIMRPYDGERSFTQNEVQTVQ
YGAFVGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGRDVLIRADEELRTKAPIQE
LGNDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASQPDEVDTEAISASVSQIAQT
IPEVTREVRLIAALMENDSNGDQLLEAARNLCNAFSDLLKAAEPESKEPPQHLINAASRV
GEATTHVLSTIAEEEVPENKDLHDMLLALAKAVANTTAALVLRAKNIAASCEDEQARNRV
IGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAARNVARAVNSLCEVCNEASADPK
LKADLLAAARDVSKSLTDMLEHVKLSTREQANRTSTELSPVENVIIGTDILVSTHDPQEM
VRHARTLGQTTAQLIQSIKGEADQQEDADMQRRLLSAAKQLADATAKLVEAARLCSSNPH
DTDNQNALRRAAEELREITTTAANTPAMKRSLIQRLEFCSKQAASAATQCISAAQNAVQH
SQDHQTKETLLQDCKRVADTIPRLVTSLKTTRAQPDEPHAQLNLIEAAEQFIEPALQVSK
SSRALQPTVTDIPSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHD
VLDDTRQAALAGQLLPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGR
DTALALGDFTKSVHGVAATTQNPAIIDCADDVVTSSARLIEQAQRTLQGAANPDALTQAG
REVTSALSAAVDCIPGQREVDVALRNVSDLSEILSMSDFPPSSRPYATLQSELKQVAEQL
SSSGGQIVVSYASPALLADSSQNFAVNYRDLLAVSMEMAGQTQEEPVRSQMIECLRHVST
QSCSLLSTAKSIAADPGQPNAKNLLHAAARGVTESINQLVDASIQSAPGQKECDNAMRNI
EALRLMLDYPHEPINEQGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVN
DSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSAKPQ
MITALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQAIKAIEEQP
VNASRERLVEPLLEAVKAVRQYASSPEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEM
VKAAKSLALQPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTR
ELDSCALAVNAQGLSQRRDNNLHGFSGQTMNSASELIDKLEPIRVAGKNNAEQLGHAVGE
ISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAVTLVQAAKDSAGNPRATHAHP
KLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTF
VDYQTRMVARAKEIASLANEINAKCSVEPAALPQLAVDMTQHYQQLTQDSVGASTTTTSP
DVAMRIRTTVIDLGRSVSSMISSSAGGARPDDVRTQKEIARSAREVSEKVAQVLAALQAG
SRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTK
VLVTGAAGTQDQLASAAQNAVSTITQLAEAVKRGACSLGSSQPDSQVMVINAVKDVASAL
GDLINCTKAASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVE
AISQEIRAMHTPPPVGSPQVNPEDLIRVTMNVTAATAKAVAAGASNLQADIVAAANLGRR
AISDMLIVCRSVAWNCAETEELRVRTLEAGTAVGESYRDLLNGILHNCSADDRMHLSRRV
AKCVTDLVAMARLLKGSDWIDPEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVKI
ELDENMKFDEMILEAAKGIMAASAALVRAANAAQRELIDQGKVARRPLTSSDDGQWSEGL
ISAARLVAAATHSLVEAAQNLVRGAGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAG
RRLQAAGNAVIKSTDNLVHAAQQGLEAEEEHSLKINTSMVDGMAQEINARSAVLRKEKEL
EEARQRLKHVRQAQRYAKNAQGFTTDESDTEYAYGTLNKSQNNTLGRSGAYYGSAGEVPS
SPSYYSSGGQQKHHYTYASPQNQHFHHPGAVSPPPANYPPVDDANGADFPPPPPPLSTTI
SNMQTATAGHSSFRPNPKLTANAVPRPYPGSPGGSNGLTSAQTQAATTPTNSNNYHSFES
TSIKSQNSSPPAVPQKPVNRNLEACVQDLHDKTFGQGGVVQLTTGGNGYPGQNYEGYTSR
YETRNFDKSSGNNTISSTSELGVVKPLESSFSQMTLNTDGGKISIVDQQGSERLTSMTQR
VMERKSFTTTTESRSETKTEKHSFRLE
Download sequence
Identical sequences B3M692
XP_001956906.1.52611 7217.FBpp0127526 FBpp0127526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]