SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0113291 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0113291
Domain Number 1 Region: 600-688
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-20
Family Third domain of FERM 0.0085
Further Details:      
 
Domain Number 2 Region: 399-510
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000043
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 3 Region: 298-352
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000968
Family Second domain of FERM 0.0069
Further Details:      
 
Weak hits

Sequence:  FBpp0113291
Domain Number - Region: 553-599
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000144
Family Second domain of FERM 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0113291   Gene: FBgn0087140   Transcript: FBtr0114799
Sequence length 710
Comment type=protein; loc=scaffold_13337:7149099..7151231; ID=FBpp0113291; name=Dana\GF10099-PA; parent=FBgn0087140,FBtr0114799; dbxref=FlyBase:FBpp0113291,FlyBase_Annotation_IDs:GF10099-PA; MD5=7f55e3b2bbd3b8cc6dae52434706b694; length=710; release=r1.3; species=Dana;
Sequence
MIHVGENSWNLRIFITDLSLEKTLRVRGDQHIGGIMLQLVDPENPKDWSDHALWWPAKNV
WLSRTRLTLDQCGVQADSLLHFTPMHKILRVQLPDLRYLDCRVDYSTKTFGAVVNLCKQL
DIRYPEELSLCKPLEAEHLKRNFAQVPHQKRVPIVEPDGTTYLQPAADTNSFVPINASFH
GDGGSTGSLDKPSAPGSFFCAPLSPHNHRGRSPMASPVPGTWKQSQIGYATYDSSSSSLG
DFQENLASSPPTPCSDVRARQLRPKSLVEKARLNVGWLDSSLSIMEQGIREYDTLCLRFK
YFTFFDLNPKYDQVRINQLYEQAKWSILNEELDATEEETLMFAALQFQVNHQTDLQPQGI
DSGIDTSSQENGGEDDIDSALNELQITLEGPNGGDPANITRIPELSDYLRFLKPQRFTLR
GYKRYYFTYRDLHLYLFKTAEESRRVPPAISINLKGCEVTPDVNLSQGKYAIRLEVPPES
GNGPNSEVWVRCENEQQYAKWMAACRLAAKGRSLADYTYESEVDGILSLLQMQRPVHGIH
VNIDPRLVEAGDYLSPKILRKLSNKAVQRILEAHSNVRELNAMESKLKYIQAWQSLPDFG
VTLFIIKFDGHRKEELLGVAHNRIMRMDLGSGDHIKTWRYNTMKAWNVNWNIKCMMIQFQ
EENVVFSCHSADCKVVHEFIGGYIFMSMRSKDNNQTLNEELFHKLTGGWS
Download sequence
Identical sequences B3M5H0
FBpp0113291 XP_001956774.1.52611 7217.FBpp0113291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]