SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0113907 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0113907
Domain Number 1 Region: 170-478
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.06e-40
Family NodB-like polysaccharide deacetylase 0.01
Further Details:      
 
Domain Number 2 Region: 67-109
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000123
Family Tachycitin 0.015
Further Details:      
 
Domain Number 3 Region: 124-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0113907   Gene: FBgn0087756   Transcript: FBtr0115415
Sequence length 543
Comment type=protein; loc=scaffold_13337:join(17193172..17193226,17194419..17194597,17194713..17194962,17198440..17199587); ID=FBpp0113907; name=Dana\GF10715-PA; parent=FBgn0087756,FBtr0115415; dbxref=FlyBase:FBpp0113907,FlyBase_Annotation_IDs:GF10715-PA; MD5=e2c2fa505db611a05ad15d7127db6445; length=543; release=r1.3; species=Dana;
Sequence
MAKLFVVFAVLALAAINEASASDSDPLLRFRRQATTEEAKKEESFEKELCKDKDAGEWFR
LVAGEGDNCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKESVKNCKSKNKERRVKPLL
HTDEPLCQDGFLACGDGNCIERGLFCNGDKDCSDGSDENTCDIDNDPNRAPPCDPTVCVL
PDCFCSEDGTAIPGDLPAKDVPMMITITFDDAINNNNIELYKEIFKNRKNPNGCDIKATY
FVSHKYTNYSAVQETARKGHEIAVHSITHNDEERFWSNATVDDWAKEMAGMRIIIEKYAN
ITDNSVVGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHG
NLQSCPTRSHAVWEMVMNELDRREDPANDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDR
HYDQNRAPLGLYFHAAWLKNNPEFLDAFLYWIDEILANHNDVYFVTMTQVIQWMQNPRTI
SEVKNFEPWREKCVVEGKPACWVPNTCKLTSKEVPGETINLQTCVRCPNNYPWVNDPTGD
GFF
Download sequence
Identical sequences B3M6J6
XP_001958039.1.52611 FBpp0113907 7217.FBpp0113907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]