SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0114771 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0114771
Domain Number 1 Region: 219-348
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-38
Family Third domain of FERM 0.000011
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-33
Family Second domain of FERM 0.0000108
Further Details:      
 
Domain Number 3 Region: 35-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.81e-21
Family First domain of FERM 0.00077
Further Details:      
 
Weak hits

Sequence:  FBpp0114771
Domain Number - Region: 985-1040,1093-1116,1165-1341
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0073
Family Methylamine dehydrogenase, H-chain 0.081
Further Details:      
 
Domain Number - Region: 861-1030
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0122
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0114771   Gene: FBgn0088619   Transcript: FBtr0116279
Sequence length 1749
Comment type=protein; loc=scaffold_13266:complement(11431843..11431908,11431969..11432079,11432280..11432444,11432564..11432668,11432764..11432985,11433403..11436384,11436752..11436804,11436861..11437026,11437776..11437928,11438182..11438300,11438362..11438720,11438775..11438927,11438990..11439435,11439566..11439715); ID=FBpp0114771; name=Dana\GF11579-PA; parent=FBgn0088619,FBtr0116279; dbxref=FlyBase:FBpp0114771,FlyBase_Annotation_IDs:GF11579-PA; MD5=dd107b4ed4c0ffb6f572238763f97301; length=1749; release=r1.3; species=Dana;
Sequence
MPAEIKPSAPAEPETPTKSKSSKPSAPSSSKAATARVTLLDGSILDVTIDRKAKGRDLVN
SICAGLNIIEKDYFGLTYETPTDPRTWLDLEKPVAKFFRSDPWPLNFAVKFYPPEPSQLQ
EDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDPKEMPTRAYLKDFKIA
PNQTAELEDKVVDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVC
ASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKL
WKSCVEHHTFFRLMTPEPDTKSTMFPRFGSKYRYKGRTQYESRATPVDRTAPKFDRTLSG
ARLTSRSMDALAMAEKEKVARKSSTLDHRGDRSADGDLSRSPIKNKKDKLMRQSSTGTAS
ASSSQSSLEGDYETNIEIEALEPLEAVSAVEAVEAGLPVQDEEKEAKLREKKQKEKEEKE
RKEREKRDLEEKKKAEKAAKAAAAAAAAAAGSGVNGNDELNDSNKSDKSSGRRGVGIFSS
GRKSKSGSPSKDGAKDKSGKDKDKEVGRLGLVVTSGLGDGQQDQQDKDKDQAAKNRGSTT
PGVTRPYEYAVDADGNASPTRKSYTPGGFRYDQDPNGRKSGEDGKEQLSPTSQQKKIGLA
FNYAPGNENALKETAEKLKAGQLSPRTQDKLNRGQLSPKSRAKLLQDPLLSPTTRAKLQG
SAVDAAAVPLSDSQKRSYSPTKGPQGYSSGAPGSYKPISDPTADFLESQRYNKEPGYQGP
AGAGAHGAAGAAGAGKTGPGAAAAAAGAAAGAAAGAAAAAAAAGKPKKKRVKIMVITSKF
DPANKRIDAENGSIEHSTGILDPATGRIDTKYGVIDPKKGTLEALNTKTGKKELYQGDVD
GKTGNLHLVSGVADPKTGRLDDTLGQIICITPQDNPVVELTVITSRIDPATGKIDTVNGD
VERSLGVLNLDTGLLDTKYGEINTRTGELKAIDPKSGKIVVSKNVKVDPGTGQITILGVV
DPKTHKLDPNQGRLIEVGQQIDPIVEVTSLAGKFDSKKNIVDPKTAQVETSGGQFDPKAG
KIDTKYGQIDLVKHTITFNDPKSGKTVTRDIKIEPATGQIVLKNQVNPKNNKPDKDYARI
ISLRIVQQRVDPATKAPIAQVSAAKDKDIVVDPKSNQIWVPTGATDPATKEQQYISSSVD
PKTGYVITIYGYLDPKTNEIKKQTKLDPNTTKIEPTSGKIYTATGESDPATGEPLFAATQ
VDPESGEVYTKLARVDPKTGKIVIVRILLISKTDERGRPEEIDPSTCEIDPVSGRVLKFF
NKTVYVYNMIDPVTGEIVQVDPNDPRFAGARTTVTHTMTLTGEIDPVTGRIKSEYGDIDP
TTGDIDPATAVTDPVTGKLILNYAQIDPSHFGKQSQVQTTTETVPITQQQFFDGVKHIGK
GALRRDSEEGDSEDEMTGQYSSDQVKDIVLGSPAGSKLGKNVSTPTVVKTTTKQVLTKNN
DGVTHNVEEEVRNLGTGEVTYSTQEHKADATPTDLSGAYVTATAVTTRTATTHEDLGKNA
KTEQLEEKTVATTRTHDPTKQQQRVVTQEVKTTATVTSGDQYQRRDSVSSTSSGDSGTPI
DGPYDGAASVVRTDNQKSPLYTTSAGTTTTGPHVESTRVVLGEDTPGYSGHGEIISTQTV
SSKTRTVETITYKTERDGIVETRVEQKITIQSDGDPIDHDKALAEAIQEATAMNPDMTVE
KIEIQQQTQ
Download sequence
Identical sequences 7217.FBpp0114771 FBpp0114771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]