SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0114931 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0114931
Domain Number 1 Region: 427-753
Classification Level Classification E-value
Superfamily L domain-like 1.53e-49
Family Internalin LRR domain 0.081
Further Details:      
 
Domain Number 2 Region: 119-465
Classification Level Classification E-value
Superfamily L domain-like 2.83e-47
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 3 Region: 844-1011
Classification Level Classification E-value
Superfamily L domain-like 3.94e-28
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 4 Region: 1104-1251
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.02e-22
Family Toll/Interleukin receptor TIR domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0114931   Gene: FBgn0088779   Transcript: FBtr0116439
Sequence length 1455
Comment type=protein; loc=scaffold_13266:complement(9609515..9613882); ID=FBpp0114931; name=Dana\GF11739-PA; parent=FBgn0088779,FBtr0116439; dbxref=FlyBase:FBpp0114931,FlyBase_Annotation_IDs:GF11739-PA; MD5=6f229229caf3377fbde1f816407181d1; length=1455; release=r1.3; species=Dana;
Sequence
MAASALPLQLLLVLAVFWPGSRLAAGALAPKESQASQESNASAMLGAGTGAAATVSLSGD
YSSLLSNAAISSSVSSPAPVPAHSGPANQCSWSYNGTSSVHCALRLIERQPGLDLQGADG
SSQLTIQCSDLYLFESSLPVAVFARLQTLEVLRLEACKLLQLPNNAFEGLATLKSLRLST
HNSEWGPTRSLELFPDSLVGLKQLTELDLGDNNLRQLPAGFLCPVGNLQVLNLTRNRIRT
AEQLGFADMNCGSGSGSAGSELQVLDASHNELRSISESWGISRLRRLQHLNLAHNNLSEL
SGEALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQHNELYELPRGLFHRLEQLL
VVDLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIG
HIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSD
LKELDLSSNQLNEVPRALQDLPMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGN
ITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLSDINGVFATLVSLL
WLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIG
PMSIPNTIELLFINNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKP
LPEFYLGGNPFECDCTMDWLQRINNLTTRQHPRVMDMGNIECVMPHARGAAVRPLSALRP
QDFLCRYESHCFALCHCCDFDACDCEMTCPTNCTCYHDQIWSTNVVDCGGQQTTELPRRV
PMDSSVVYLDGNNFPVLKNHAFIGRKNLRALYVNGSQVAAIQNRTFASLASLQLLHLADN
KLRSLHGYEFEQLSALRELYLQNNQLTTIENATLAPLAALELLRIDGNRLVTLPIWQLHA
VHFGSRLRSLTLGKNPWSCRCQFLQALTSYVADNALIVQDAQDIYCMALSSSSSRGSSNL
EDGYAQESDMEKRELDFNATGAACTDYYSGGSMLQHGIPESYIPLLAAALALVFLLVVIA
MVFAFRESLRIWLFAHYGVRVFGPRCEESEKLYDALLLHSAKDSEFVCQHLAGQLETGRP
PLRVCLQHRDLAHDATHYQLLEATRVSRRVVILLTRNFLQTEWARCELRRSVHDALRGRP
QKLVIIEEPEVAFEAESDIELLPYLKTSAVHRIRRSDRHFWEKLRYALPVDYPTFRGNNY
TLELDHHHNHERVKQPASPGLLYRQAPPPAYDGVPPTAQQQQQQQQQNPGALEQNYSTAT
TATPSPRPQRRDVGPAPGVGPGAGNHHLRAEYYQHHGMRPPSEHIYSSIDSDYSTLDNEQ
HMLMMPGGHPMEGAQRAQTWRPKREQLQQQHPQVQAGTLGSKASQQHQQQQQQAQQQTGS
VAGQQQGPHVQAYLV
Download sequence
Identical sequences B3MH72
FBpp0114931 7217.FBpp0114931 XP_001960027.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]