SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0115576 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0115576
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 8.24e-39
Family MIR domain 0.003
Further Details:      
 
Domain Number 2 Region: 1083-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-20
Family SPRY domain 0.025
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000116
Family SPRY domain 0.062
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4190-4252
Classification Level Classification E-value
Superfamily EF-hand 0.0000005
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 6 Region: 2250-2348
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000327
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0115576
Domain Number - Region: 452-630
Classification Level Classification E-value
Superfamily ARM repeat 0.00719
Family GUN4-associated domain 0.072
Further Details:      
 
Domain Number - Region: 1531-1656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0253
Family SPRY domain 0.03
Further Details:      
 
Domain Number - Region: 3086-3236,3274-3301,3337-3438
Classification Level Classification E-value
Superfamily ARM repeat 0.0288
Family PHAT domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0115576   Gene: FBgn0089421   Transcript: FBtr0117084
Sequence length 5111
Comment type=protein; loc=scaffold_13266:complement(1241188..1243870,1243929..1244130,1246449..1246868,1246925..1247035,1247312..1247612,1248068..1248413,1249088..1249200,1250643..1252740,1252800..1253086,1253242..1253379,1253719..1254198,1254258..1254392,1254407..1256496,1256566..1256681,1256759..1256953,1257167..1258326,1258391..1259144,1259543..1259747,1261273..1261372,1261544..1262147,1262200..1263622,1263684..1263808,1263865..1264389,1264442..1264830,1264889..1264966,1265949..1266152,1268321..1268374); ID=FBpp0115576; name=Dana\GF12384-PA; parent=FBgn0089421,FBtr0117084; dbxref=FlyBase:FBpp0115576,FlyBase_Annotation_IDs:GF12384-PA; MD5=25b1ae11db68d859167d747936130cfc; length=5111; release=r1.3; species=Dana;
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVVYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSNELIL
VKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITALE
TLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGS
SMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAYLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGGKVRGSFRDFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPHQILSLDPCFYFGNLSKN
VLAGPWLIEDDTAFVPKPVDTTGVSLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHR
DDYHRIHPCLTQFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRLPNEI
FMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSDNHRS
PHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFAAFRT
YRVEKNYAVTSGKWYFEFEVLTAGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHA
GSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFADVTAEGVGFVPAC
TLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMP
DCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMSEFINEQEKARRWD
EIKNRQYRLMREAEAAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHMM
RGPSRPPRKGSLTRNITFETDMSAALDEMHRSSSVLDMNGLGDEMDDKKKRGRSPFKFFS
KKSRDQSREKMGRSQDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNADIPPSPVPQGPK
QLSGSTLGQPPVESSGEEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLHSK
EFNKNKVRRGSVYIENDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGCF
VDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAAV
LPTSDKHISPQSPPRLKVQCLRPNQWARVPNTALQVHALKLSDIRGWSMLCEDPVSMLAL
HIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIR
SEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGPELKELYSEDEMQHSLRSLI
TESVRPQLRMTEITPPVIATSSLPSVSSEPIPNIDQLYSPKFPLEVVRQFVMEALKDAVE
INQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDAAFEREGK
DEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIE
IKQSDLPSAVAAKKTKEFRCPPREQMNQILCFKNLEADDQDNCTCGLELRGRLGDFHDSL
MQKVSLNALQEPDGVEGAAIEEIKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPEEVF
RKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINNRARDDVAE
MWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNT
LGRRAQAQSDAPTQTEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDF
LLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSEL
VEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGE
GLFRAIVEANRMSERISDRCKMQDEAEGTIAGLNFTHPLPESDEDEDYIDTGAAILNFYC
TLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLSQTAPGEEKPK
SDMPSGLLPNNKQSIVLFLERVYGIETQDLFYRLLEDAFLPDLRTATILDKSDGSESDMA
LAMNRYIGNSILPLLIQHSQFYHEARKTIGCPRTGQREAVSDFLVALTSQMQPAMLLKLL
RKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKRLTMLLFSNIF
DSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYGRQMGAPDQPQYMPNPID
TTNVHLDNDLNSLVQKFSEHYHDAWASRRLEGSWTYGEIRSDNDRKHPRLKPYNMLSEYE
RERYRDPVRECLKGLLAIGWTVEHSEVEVPLNHRGSTRRQSKPQIHDFQNEGSPFNYNPH
PVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQLVPYDLLTDKEKKK
DRERSQEFLKYMQYQGYKLHKPSKGGAVEEGGATQAAVELRFSYSLLEKLIQYLDRATIN
MKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATNNIGAASL
KEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTLTKNCPEFIRTSML
TFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAMFDHLAACDYG
SDLLLDEIQVASYKILAALYHLGTDATLTHDRKYLKTEIERHRPALGSCLGAYSSCFPVA
FLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESCMPNLETILSEVDQFVESDKTYNDAP
HIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTADHMNPLLRNVLKMIKKNIGNDN
APWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDSMRGFIKSATDDTS
QVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHVAEIFNIWSKS
QYFLKEEQNFISANEIDNMALIMPTATRRSAISEGVPAVGGKVKKKKKNRDKKRDKDKEV
QASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMPEYDVIEFARNQLTLPDKLDP
SDEMSWQHYLYSKLGKTEEPVDEQALEKANVNANEKGKDKTTETVDRIVAMAKVLFGLHM
IDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFARSYYEQWLQEENVG
QEVMVEDLTQTFEDSEKSKKDEEETDSKPDPLTQLVTTFCRGAMTERSGALQEDLLYMSY
AQIAAKSCGEEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLLFHQARLSNRGVAEMVLL
HISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSV
LDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNYLRTQA
GNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFFKAIGVASQVFNTLTE
VIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMM
LSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLADLIESPSFHEIDMKNEGW
VTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVERFHEPSKEIGFNLAVLL
TNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNIEQWEK
PQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGGNVKRDTAY
SSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPELIVGFF
KIIFYIFYYTGYAHFCVVRYIFGILLNLMRGPAPEQEEEPVVEEETFGRALPPLPLEEPP
GTVQAFGLDINKEENGMYKVVVHESPANSSMEEGGESSPEDGAAPAGELVEGEPHQEPIS
IVDLLGGEAAKKAAQERQEAQKAQEAAMASIEAEAKKSSSAPQETPAVHQIDFSQYTHRA
VSFLARNFYNLKYVALVLAFSINFMLLFYKVTTLVEESDGSGEEELILGSGSGGGADITG
SGFGGGSGDGGSGDGEIEDDVPELVHVDEDFFYMEHVLRIAAMLHSLVSLAMLIAYYHLK
VPLAIFKREKEIARRLEFDGLFIAEQPEDDDFKSHWDKLVISVKSFPVNYWDKFVKKKVR
QKYSETYDFDSISNLLGMEKSAFAAQESEETGIFKYIMNIDWRYQVWKAGVTFTDNAFLY
SLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIY
TVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVY
RIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFFDIVP
HGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGDCFRKQY
EDELSGGGGGG
Download sequence
Identical sequences 7217.FBpp0115576 FBpp0115576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]