SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0116208 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0116208
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000177
Family First domain of FERM 0.0084
Further Details:      
 
Domain Number 2 Region: 92-144,255-312
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000427
Family Second domain of FERM 0.0061
Further Details:      
 
Domain Number 3 Region: 310-416
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000615
Family Third domain of FERM 0.022
Further Details:      
 
Weak hits

Sequence:  FBpp0116208
Domain Number - Region: 526-573
Classification Level Classification E-value
Superfamily RING/U-box 0.00023
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0116208   Gene: FBgn0090049   Transcript: FBtr0117716
Sequence length 645
Comment type=protein; loc=scaffold_13266:join(7279153..7279239,7296753..7297708,7297767..7298396,7298458..7298722); ID=FBpp0116208; name=Dana\GF13016-PA; parent=FBgn0090049,FBtr0117716; dbxref=FlyBase:FBpp0116208,FlyBase_Annotation_IDs:GF13016-PA; MD5=21018db8bb8165f24bd4b71c03c349e2; length=645; release=r1.3; species=Dana;
Sequence
MWCIVNLPNGTQQAVKWDPKANGQECLEKVCRALNIICEMEYFGLEHWTPNQKESQTRQW
INLRNRLSGDSGSSGSGIQLMLALRVKFWVPVHFILQESVRNLFYMQARRDLLEGRLSAL
DWSGAAKLAALLCQADGLRFNESSVRAECPIRMRRELAQQQQQQQQQQQQQRKEKENALS
FKKRRLSKQKSMEHIETCTLPVATTQIHSFSLQPSPSASASASTSACSQTHSNSSSSSPS
NSSSQTGLDERLATNPLRMYEEYLIQPSSEGEPPADYLRQIATEHGKLAKLQMSPKSAKY
WLLQSIQDLEGYGEELFSGVTTNESATRCDIAVGAHGITVSRGGEKQSIPFGAIAAAKSL
RRTFKLEYVDDHNDRKELEIKLPKQPIAAGLYRSITERHAFYVCDKVRGVVTNQFTRDLK
GTIASMFMENTELGKRYVFDIQHTCREVHDQARRTLHERGGDLAAEGAEGFSSGAVDGGA
AAIDPLGAAGSSAGACGSMAGKIDLAIREKEAREAAIERCVDTRISEAMQCKICMDRAIN
TVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYLPPELRTSQSGSGVAISTSSCNSQ
IEEPDMEELEMTTSMGGGGSEAGVGVAEGGSAVGPGGQPKVTTAA
Download sequence
Identical sequences FBpp0116208 7217.FBpp0116208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]