SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0118549 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0118549
Domain Number 1 Region: 226-527
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.36e-39
Family NodB-like polysaccharide deacetylase 0.022
Further Details:      
 
Domain Number 2 Region: 120-169
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000549
Family Tachycitin 0.027
Further Details:      
 
Domain Number 3 Region: 181-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0118549   Gene: FBgn0092382   Transcript: FBtr0120057
Sequence length 589
Comment type=protein; loc=scaffold_12916:join(7296648..7296837,7298108..7298885,7298939..7299461,7299529..7299807); ID=FBpp0118549; name=Dana\GF15357-PA; parent=FBgn0092382,FBtr0120057; dbxref=FlyBase:FBpp0118549,FlyBase_Annotation_IDs:GF15357-PA; MD5=a220e49acaeb892dbde33501d3667444; length=589; release=r1.3; species=Dana;
Sequence
MLSPGENLNWQTGFTVKVVASAQRRRRRRRLSVRNFVLNPQILLASILMVVIMSISSLDA
RGIDNDGIISSGTNFTRHRRSTSGSVTGAAAAAAATPANCMQDARFYRNPNRPVHKIWTN
SECAKYFLCLDGEVFEFKCSEGLLFDVVRQICDFKANVDNCDVSAETPAPKPLLEMADCA
DEYQLGCADGTCLPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRNCQLPHCFCSK
DGTQIPGNVPAQSVPQMILLTFDDAINHDNWELFSKVLFTQNRRNPNGCPIKGTFYVSHP
FTNYQYVQKLWNDGHEIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAGVRME
EIRGMRVPFLRVGWNRQFLMMKEFGFVYDASMVAPHSNPPLWPYTLDYKMPHSCTGMNQN
CPSRSYPGIWELVMNQLEAGDYMCGMVDSCPPHFNGEDVYRMLTHNFKRHYLSNRAPFGL
YFHSTWFKKIDYLNAFLKFLDDLQKLPDVHFVTNQQAIEWMRHPTPSNQLHQFESWHCKP
KDLDPHERVCSLPNVCKVRSRVLQEDRYFYTCMECPAQYPWIRNEFGLD
Download sequence
Identical sequences B3MK27
FBpp0118549 7217.FBpp0118549 XP_001962224.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]