SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0118589 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0118589
Domain Number 1 Region: 961-1247
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.55e-63
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00015
Further Details:      
 
Domain Number 2 Region: 109-220
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-21
Family Second domain of FERM 0.0014
Further Details:      
 
Domain Number 3 Region: 221-315
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-20
Family Third domain of FERM 0.0069
Further Details:      
 
Domain Number 4 Region: 27-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000145
Family First domain of FERM 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0118589   Gene: FBgn0092422   Transcript: FBtr0120097
Sequence length 1251
Comment type=protein; loc=scaffold_12916:join(7897695..7897779,7898084..7900037,7900093..7900960,7901021..7901239,7901301..7901477,7901536..7901859,7901921..7902049); ID=FBpp0118589; name=Dana\GF15397-PA; parent=FBgn0092422,FBtr0120097; dbxref=FlyBase:FBpp0118589,FlyBase_Annotation_IDs:GF15397-PA; MD5=0c1b3b99f047897ffc0e2d7660d1fdf3; length=1251; release=r1.3; species=Dana;
Sequence
MPLKFLKKCRQYNVTSKSLFVISVHHLLDTSSTVDCTISSESKGQECLDNVCQRLVIHQS
EFFGFRYLVKGKEDEYKWIDLERSLSRQLEKYASGTKIYLRVRHYVTTDVRLLSDEATRF
YYFLQLKSDIYEGRIACDIRTAILLALYCRQAEYDSYQGDKQSKDYLKKSLVLPRNMQGL
ANDDSMLEGLIVEVLQQQPGLAHLSQSQAEEMYIKCCQHLDGYGEERFAAKDTLGNDMLL
GLAINGMVVNSDNGRQYFPWKDFQTVTIDKRTIKIEQNKLDGDGSIVGSFIFSEADTARY
FWKLCISQHKFFKRYIDTATSSSLGSGAEVESGPQGDYDYADVAAVDLQKQQQMQQQQNQ
QLQHQQQQQQIQQQHQQMMLSSNISLAASQSQSQLLGQSSSCLDLSNNNLHSSNGMLHHV
SGNNNDERERLKAMLPTYRPAPDYETAVQLKYRTPSAELHNVALALAAPGNAYFAGSQPD
VHNPGVYTENLLYGHLTSHRYPDVAQPAALHHHINLYQTQQQHQQQPQPVSTAQAYLELS
QRMHMLRHKAPPPYPVNRLSSSSTPDLAVATPRPLHGYRNYVSGSSPDLVSNRTLLNGGQ
YLALAAGNHAGNMPTSSGATMLHQYPYVGHMGHSQPYLPPQGTFENLNMIEEQPSIMSQL
RQSAMSQAAAAAASAVVSHNSSTLPPSGYRSSVPPPASSPQPPPVTATPQKVTAPTPLQR
SVENGSIEPIYENVPLPQRASGGSSGAAHAEAMRQRASSIQSAPPGVVPVPAARHTSTTN
ITVNAPPEDELTRNIKIFAADRAASSEMQLMEPQSPKRASRAASAAPTVGVTLPNRQYRS
TVSLNKSPTVDAISPANDSLQQQFSAMNLSANTSASTSSVFNSTLDTTYSSAASKDTKRK
KRWNFLARSKTPDKQKAATLGREKATAGQHAKLAAKLKLAQDDLNLPNRWSVGVSKPQPI
SGRYSKDKLCQILTEKLQDSQLFMEFERIPKRREHALYECALLEENESKNHDPNFLPYDD
NRVRLTPSMDNRHGYVNASYISATVGIKQRFYIVAQSPQDTQTMRIFWQCVWEADVYLVV
QLVEDISYIPQTSQQRLEFGQFQVYQEFSQTTDRCTTSKLRLFHAPSRRYRSVWHLQYAD
WAEQNCPRDLNHFLDFLEELNSVRLASTHEVPPGHNTNPPVLIHCLEGGGRSGVTLTADL
LLYTLDHNEDLDIPRVIGQLRHQRDSIIPSLAQYKFIYNLLVTYLKRTRLI
Download sequence
Identical sequences B3MKG1
XP_001962293.1.52611 7217.FBpp0118589 FBpp0118589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]