SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0118962 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0118962
Domain Number 1 Region: 198-346
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-32
Family Third domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 103-200
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-22
Family Second domain of FERM 0.00037
Further Details:      
 
Domain Number 3 Region: 12-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-22
Family First domain of FERM 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0118962   Gene: FBgn0092794   Transcript: FBtr0120470
Sequence length 571
Comment type=protein; loc=scaffold_12916:join(14177888..14177977,14178504..14178608,14178675..14178717,14178779..14178952,14179013..14179392,14179453..14179541,14185065..14185282,14185340..14185956); ID=FBpp0118962; name=Dana\GF15770-PA; parent=FBgn0092794,FBtr0120470; dbxref=FlyBase:FBpp0118962,FlyBase_Annotation_IDs:GF15770-PA; MD5=55f9d608a592ee36e5f322aea3221528; length=571; release=r1.3; species=Dana;
Sequence
MFRSKNEGNIVYKCTVRLLDDSDVLECEFQPFHKGIYLLEYLCGELEIKEKDYFGLRYVD
SSKQRHWLDLSKSIIKQCKDLDPMLFSLRVKFYPADPFRLTGNARIMLYQQLKRDLRHGR
LYCSLGEAAALGALIVQEELGDYNEDVHIGSYVSSIELALRQTEYLEKKIIELHKKREPG
QDLSLAMDEFLGIARGLETYGIDPHPVKDHRGSQQYIGINNSGISTFVTGKRSQHFRWNE
IHKINFEGKMFIAHLSYTDASREPKKHTVGFKCPTGAACRYLWRCAIEQMLFFTLPNSQS
AAVISGGGFFSWGTKFRYTGRTEREILTENINALREQKLNNSNSSKRKASSVPATPSSPQ
GDLAQIRYSSLPRSTMSEPLGYAIPNGSHCYVGQDHEGNGGIQISSLEPVCEEARLRSSN
VDGPNYLSTQMGYAYRDSVEHSSTESGLTVNGYDHPRKHEAKQHGTWSSPNAYYGHSADA
TFNPSSTADHFLRGDPSVQKVKKFRKFHLLHAFVPSVIFVAFAMAGTAVFIMESESEAFE
QLRNSPEMLCLRYQYYQPLKDFVFEKFGRSK
Download sequence
Identical sequences B3MPS0
FBpp0118962 XP_001963097.1.52611 7217.FBpp0118962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]