SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0120972 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0120972
Domain Number 1 Region: 169-315
Classification Level Classification E-value
Superfamily PH domain-like 9.43e-36
Family Third domain of FERM 0.0005
Further Details:      
 
Domain Number 2 Region: 67-171
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-33
Family Second domain of FERM 0.0000425
Further Details:      
 
Domain Number 3 Region: 3-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-17
Family First domain of FERM 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0120972   Gene: FBgn0094798   Transcript: FBtr0122480
Sequence length 1275
Comment type=protein; loc=scaffold_13340:join(5054743..5054847,5055186..5055310,5056669..5056766,5056830..5057038,5057945..5058097,5059107..5059279,5060947..5061192,5063103..5063552,5064066..5064464,5064527..5064811,5064881..5065021,5065089..5065235,5065324..5066620); ID=FBpp0120972; name=Dana\GF17780-PA; parent=FBgn0094798,FBtr0122480; dbxref=FlyBase:FBpp0120972,FlyBase_Annotation_IDs:GF17780-PA; MD5=9bc2fa5cf2bc5443e8fe75ba2d377792; length=1275; release=r1.3; species=Dana;
Sequence
DDLPGQALLDVVFARLNLIETSYFGIRYIDEENQTHWLDPASRISRQLKPKSDPYDLYFG
VKFYAADPCKLLEEITRYQLFLQVKQDVLQGRLPVAFELAAELGAFVVQSELGDYDQRRH
SKGYVSEFRLLPNQSSELETRVSELHQQLKGMSPSSAELNYLDKVKWHDMYGVDLHPVLG
EDSVEYFLGLTPSGIVVLRNKTTVAHYYWPRIAKVYYKGRYFMLRISDKNNELSTYGFET
PRKSACKHLWRCCVEHHAFFRQVRVAPLPSSQSHATDLFQLGSRFRHSRPDKQTEKDELA
AGRSPPAFTRTPSKRQPRRVIDDFFNSNGNGNGNGTISTNGNGSGAAGGPGGVHMGNRPL
PQPGLGTISNNYDSPYRSTYSIPTSLGIRPCHQQQQNNNSSSYNNNSGGNLQTPDSPRST
RSAPWPRSQQRSLFGHNPSSPRSVRSASTAGGGLHHHHSHHSHGHGTSHHPHHQSSSAAA
SSHHQRQQRASSSSASHQQQRYRSSSVESHSSNDSRSTRRHKHRHRRTSDNESELSRGSG
RSGRSGRSHHRKHRRSHRHRRDSAGGSDHDSNRGRSYSGHRSSSMRSGSAELIDSTSQWR
EVQRRQAEASLGQSSVQQAAVSKSSMVARSLHSNDSHSDTHSHHKSRRHRKNKSPSESRS
RMWNSELAKHLQFDLVDTEGMSEQQLREIPYTVVETNSKRSNSNLKIHKSNSKSSVGAKS
TGSGNTITNGSGSGNAGQARNRVDRIRGLYYQSSHPHDSNGVGVGNGGHAPKNGSIRSAS
TISSRECERNNGLVRMMSSMSMGDFISPTGSNLSPLENSALRVSHEHTDSGLGADQDYAY
SSERSSDSTRYGTNKSSGASSGSHRKSGGSAGGGNSGGYNSLMQQTVSNQQQQQRSLFAQ
QQRQQQQKSNYKYATSSPSNTNPASGSNSGLAPVHNPSSASPNPNPNANSNPNPNTGANG
NATNPTASPANRLLHYTTFENNQYKFSLNNALVRNSKGVSGGSSSNIPGGGASGGGGAFS
RQRSFVEWPSNPAAPYYYQGPSTHVAQAKRRDAKSDIGVPTRRLSGQSITKTQLLTGGHS
QLANAGCYPLHYASSSVTGSAYNRPPGQRSGGGGGGMAGGGGPSGGFGLQPAKSDLFLSY
IHGGEYERPYIYNYKMPQMPAGGGGSGGSPKQQPTAYHISGSQTADPPPPPPPLYGGTAP
ANDVMYYQFDKGAAPSTSAPPPIVQQPRQSSAGGCGGGGGGGGGGPLVYLQHGQNASVSG
GSSSVGAVQPTVSTP
Download sequence
Identical sequences FBpp0120972 7217.FBpp0120972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]