SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0122110 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0122110
Domain Number 1 Region: 255-400
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-39
Family Third domain of FERM 0.00033
Further Details:      
 
Domain Number 2 Region: 151-257
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-29
Family Second domain of FERM 0.0000764
Further Details:      
 
Domain Number 3 Region: 68-151
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.77e-19
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0122110   Gene: FBgn0095932   Transcript: FBtr0123618
Sequence length 4295
Comment type=protein; loc=scaffold_13340:join(22954463..22954714,22959969..22960201,22960258..22960479,22960545..22960788,22960847..22961007,22961065..22961139,22962923..22963029,22963279..22963394,22963459..22963711,22964204..22970025,22970085..22975487); ID=FBpp0122110; name=Dana\GF18918-PA; parent=FBgn0095932,FBtr0123618; dbxref=FlyBase:FBpp0122110,FlyBase_Annotation_IDs:GF18918-PA; MD5=0865935cd40a8fa4c2da64dd4c95e283; length=4295; release=r1.3; species=Dana;
Sequence
MSLADMGTASRSAAGGGGGGGGGGRHYDLASGGGGGLPGGRMTHSLSTPSGVDGTPSTPR
HRGGKKLTVRIQMLDDTVTMFQVQAKALGRVLFEQVCRQLNLLEADYFGLEYQEVSTHTK
YWLDLEKPMNRQVGLSLIDPVLRFCIKFYTPDPAQLEEEYTRYLFCLQIKRDLATGSLQC
NDNTAALMASYIVQASCGDFVPEDYPDHTYLSSYRFVPHQDATMQRKIMENHKKHVGQSP
AEADLNLLETARRCELYGMKMHPAKDVEGVPLNLAVAHMGITVFQNITRINTFSWAKIRK
ISFKRKRFLVKLHPEGYGYYKDTVEFFFEGRNECKNFWKKCVENHGFFRCTAVQNTPRRK
TRVLSRGSSFRYSGKTQKQIIEFVRENYVKRQNFQRSQSFRQGPLNASSRSQSHTYVNSS
ISANPLLPIDTAAWDYRNQCSDSMTPSLTKKAADTLDRRRDNPTDHMRSQVTAAQVEIYQ
TKNYAPDSPTSPEEAACSAAERQHHSAAAMDQMNSNRSLSPQGPQSWTSPSHSNSLHQQR
APDQARVHPGDHNLGLSHLSHLYSSSTPRRVSVGSQAYAPASPQLISINTHSSSNTHTNN
NIISTMLSTHTPVRSVDLNSSMELEEEEPGPADTEEEGEPMGEEEEEELVEEEADSDLTA
STTNRETMVAASVAGASVSGLASGSVLASAHRQQLRSQESQSQTVTPVHYSSTNYSMSKQ
CMLNNANANSTETETDNIIYTDINDMGHYKYPDFHSSAHQEHKISNSEHLNLNERNDIYA
TVNRKAKSKTREKHFSDEFIDQSILQYTRAKQMGLSHVPLLQQPSTSAYAAAVQERSYNS
GSYQYHNDLNHPSESSSSSYFGTGFGTKRYGQGERVKLAQSENYLTPSVDSQSSRHTHSL
PRNSELSGVDSVDSYDSHYITHHSVGNLPPVRQSSSSEKLDYHLTPGGLYSTTQFVKPEE
AAAHYMDDEEEEDEGEDGENIYDQVERESWLKSSSCKDLFERYSSTYYDRELPKPMTAFD
KEFLSSNRIDSPVTRYDDSRHSLYVTKNHSIDAHQDFSPLPQSKVYSSSYPGSTYNTQEH
KRQHGHHLDYSGSQDDISQDSYELLEKYDIDFFGGRHRSEDHMRSCSLDSGNYIPSDDES
VSEGQQQPKYRSAIDVKSKSAADIMNEIWDAEDPRYLPREKLSVKSDGNFYKKIQETLAL
TRTSSQESQSEMFETKISRSSDSSKKSRDSLYHTDSKKSRETTKSKTSVASSQDSKESLV
GDCFGRNYEMPTTTGKKVKQFTKKELYEKFAQSSQESKSDYYDAVETGVEPPPEGLYSRP
KVKSHDCLLSDTHSSTANSSFYDSRDTYSTFPSNKTHKTSKVHSISLQNVEIERNAKSFG
SKSPESVSTPASGKRCREKDIQTGDSLDKMAPMKRGNSQSCKISAFRRRSDSENIFSFDQ
DRIECIQKYTKQWEGQQQKDEKSKQSPEYPLTPELVSEFEKQQARLMAHQKITRKEELIA
KTHFEEYNPIMVPMSYSSHATVERTKSDPNSLANRARLGSNSRRHVLMHQKSIDLTPADS
NSSDEDYMYKQIPSAPPLCKAHGNFEIPKCYDGASSAQLAQELPKTGFELPKSFFRDYER
RFTKVLKEDIPYVLHKRHIMNGTAPSPSEKKHNKPKSPKSPKSPKSPKSPKSPKSPKASV
TLPGAGASDFLPDILDSLLPAETKEFLFTQNIDLSKVDPITLEIDKTIPIIQLSSPKRDI
TKQMDACTLEKLNKKLSQIESDSATSSRTESMQQQKLEQKQMELIQSLRKELQLNARKAN
KPRVIPKTKSTGKSKKGKTRITSFSSDDESLDSDDVFGSAEAIPDRLEFSPPQSRKEIES
ILRIEQSRLISAAWGRGQTMSSTEIEGSPPQCRRLAELESRYHPQKLDPQYANATELRRI
SERSISIPSSEDEPHVPMRGRMDECTNDYQRNENIPSPILEHAEFFRSNDDIYETCHEEK
ITGSDIDYTLKKQTASGAKSKVKLIEEIIDSSIVMRSKGHAPILFAHARLNLSEGSVSLQ
RQKATQQQSPTTERRTKSLDTPVISLHRLPPMNAFSSKDDTVGFEEEAEILEEKSLERGN
QSAAPDDDAADSVHSCAGSIPTQGSNQTNGRDSLISAVTIDSEEAELLNQLKYIEKIALQ
GVKIKDKKKSKMKLRSGDHLILNIPKYRFTDWSPYSSANSSRKTSPGVSRASSIESTGKG
KLKTSEPFKGKVSRSRPESRRTSADDIKARDGRGSKKSSPKERPRSIEMRRLSKDKSKSQ
EETEADIAKRKERQQKLYESAMKQTITMLSPVKDTMPAFPAPEDKILVKTDGDKIIIETE
FKSKAEDHVLIAKSPRKLDNSLVKFSRSFDEGRSPDKLDKANRSFEDRNKSFEDSEKSEA
LEDMLIKSPKKIAKAQEVKQRIEGSVVHKKIDGKSSSLEKPGEHHYLGGDAKARSLDDKR
QAAEAAKKSEEKPAPAARSAVGDRRMFAHQYQIQEPLQEDIDMQAVIMERRSLEILKRSL
PSEDARDSEGGISRKASTAESLDSFVSADNSHSPASKSPIPGSTGGAEGYPHRVPTIECE
EPSIEEDDNSLERRHLRVGRQDTNRLSLDRSRSDETGSWMTVECDEFIGSDTSENEPRTL
EPDRNILETQATLEDANPLEYSNCATPTSDLNILVTPPNASPQIEKSILETFEKYTSDSS
KKKHSLDKQSDRSKSSDSWTSGEKDTSPQRQQDSSLSVGKEKSSVEEESSVSCSIARPLG
ISQEFGNEEARQCHELKLRMLRLDVGKEDISPTGSNEQTPTNEPKTTMLGRKPSTPTLEK
QSPIDLGTSTESYLDPIEERISKILERGTIRTEDSESSSGGSRKPPRIEKPARANAGKKL
SVTRAEPGKSGSDRSSQESKSSFDSKGSLSVESRGSFETESSSGSLGAAQRRGDLAQKEQ
QSTWRPFPIESSNSSSTDDPWHHLETDGGYERYDAQNPLRDSSDSDVKEVSPDEQKDASD
TSYQDELNDFPATFGYPAMTSNLSGIGVNPTDIIGYSTGFTLGRTLSRISERSTASEKSS
MEDDMSKASTHSVSMRDESIGSTDHQPSLSSDSRSNTNLAYISDADRRTSAEMPEIPCDS
ATGDRLSSFGSANDPKSPTMVTGRFSVTHVDEHTGEDADRHTLMCLSNAGSQDSEDWPLP
EIPFDHVPIKPADALYGMPDLDKPVPKSFCWKASLAFQQSQESIDWPSPPSSAVGAPVIV
ESIETYYASEAQSADQVVLDEEMAMGPPDVARVLPYEDTAYLMSAAFEDKDFGSEQLQPD
PVSCLSSTLSAASCLSSSLNVSCTTSSTQATARAQRKNSSPEVIMAQPTRSPAPRSPLSE
EEMFSSDDVFMPGTIKVQLSPDAQLRKLSRGSNNSDTSIDDILSGSGTYDQTTVRRNYES
RLSSGGGAAGGCKKCSHSSHSEEETSSMGTDIDGTVRMGGLAQRKCTHSSHSEDTSIGLS
ISEWSTGTNTVRQYANLSGSDSLSAVSTQSCAKSEKSNQTKSSISSINKSAESLNEGSGG
SSFSHKFSGDNGSSDGLRYDMLSNSDTDKLSETTSATRSDDTTLSLTEMAQTISEWSTSS
SRTLVGVAPGEYMPLKQSRVGSKTSLNSPSEEKRCSLPQVHRRSGSNGNQGRSSQEQVDT
TQGPETSAAARKRRSLEMMSKLYQSQEICSESESPFVERLYAHTEKLTERYQSQEFVPLH
GATSSTAPAPQPAAKQMQAQQPQQVRQKAKAPQPPVAPKPSVTRPIMQALLNKMKQPGFA
EEAAAAAEAEEQGKAKGTAPAPPQAVVKPPPPPVPTIPPIVTPSDLPGEVVAPPPKPLAK
HHSYDDRTMSKTQIREFKTTSKQLRQSSSFHEHMLSKSQQSSQELPMRIDEERDAHSTSS
ATNTTTTTNTLNSESTEPNSPQMPQRADKLVRCSPYYSSSLSSESPPNQLIQKPPRKVAS
QLCAGAVATALKSPPSGNDTDSSLDVRGQEAKMRSRGYRKKRQLPAKRMRANLTAAALLE
QAESSECSEGYVPEVDSGSSEYSSCQRDDQYLEFDEELERDQEQTDEYDDYPQYSGKFES
LDMSDNVDEMGFPRYDRLGHITKPMYHQALAMDRPIVVQVPAAANHPMPPATGQPVKPAR
TKKRQLKREDSMAAGTSAGVVPVQPYHGRNYCNPEESEYETRGGGLSDEMANSSEDSCSG
FGGGAGAAGSGTIRRGAARGSGHDQQAAGGGAAGGGGGGGPAAGTSAQSRQQLPYPDFLS
DYETEPIEYERYACGLDIRVDPPPKFHDSDDLSDQ
Download sequence
Identical sequences B3M146
XP_001955755.1.52611 XP_014767157.1.52611 XP_014767158.1.52611 XP_014767159.1.52611 XP_014767160.1.52611 XP_014767161.1.52611 7217.FBpp0122110 FBpp0122110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]